KEGG   Mus musculus (mouse): 14083Help
Entry
14083             CDS       T01002                                 

Gene name
Ptk2, FADK_1, FAK, FRNK, Fadk, p125FAK
Definition
(RefSeq) PTK2 protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    14083 (Ptk2)
   04370 VEGF signaling pathway
    14083 (Ptk2)
   04151 PI3K-Akt signaling pathway
    14083 (Ptk2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14083 (Ptk2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14083 (Ptk2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    14083 (Ptk2)
   04062 Chemokine signaling pathway
    14083 (Ptk2)
  09158 Development
   04360 Axon guidance
    14083 (Ptk2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14083 (Ptk2)
   05202 Transcriptional misregulation in cancer
    14083 (Ptk2)
   05205 Proteoglycans in cancer
    14083 (Ptk2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    14083 (Ptk2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14083 (Ptk2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    14083 (Ptk2)
   05100 Bacterial invasion of epithelial cells
    14083 (Ptk2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14083 (Ptk2)
   05163 Human cytomegalovirus infection
    14083 (Ptk2)
   05165 Human papillomavirus infection
    14083 (Ptk2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14083 (Ptk2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    14083 (Ptk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14083 (Ptk2)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    14083 (Ptk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14083 (Ptk2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  FAK family
   14083 (Ptk2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     14083 (Ptk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase FERM_F2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 14083
NCBI-ProteinID: NP_032008
MGI: 95481
Ensembl: ENSMUSG00000022607
UniProt: P34152
LinkDB All DBs
Structure
PDB: 

Position
15 D3; 15 33.94 cM
AA seq 1052 aa AA seqDB search
MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQE
MSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcttatcttgacccaaacttgaatcacacaccaagttcgagtactaagact
cacctgggtactggcatggaacggtcccctggtgcaatggaacgagtattaaaggtcttt
cattattttgaaagcagtagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcacgtg
gcctgctatggatttcgcctcagtcacctgcgatcggaggaggtgcactggctgcacgtg
gacatgggtgtctccagtgtgagggagaaatatgaactcgcccacccaccagaggagtgg
aaatatgagttgagaattcgttacttgccaaaaggatttctaaaccagtttactgaagat
aagccaacattgaatttcttctatcaacaggtgaagagtgactacatgcaagaaatagct
gatcaagtagaccaagaaatagctttgaagttgggttgtttggaaattaggcgatcctat
tgggagatgaggggtaatgccctagagaagaagtccaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaagctgatccagcaaacattcaggcagtttgccaaccttaatagagaagaaagcatc
ctgaaattctttgagattctttctcctgtgtacagatttgacaaagagtgcttcaagtgt
gcccttgggtcaagttggatcatttctgtggaattggcaatcggcccagaagaagggatc
agttacctgacagacaaaggctgcaatcccacacacctagcagactttaaccaagtgcag
accatccagtactcaaacagtgaagacaaagacaggaaaggaatgctacaactcaaaatc
gctggtgctcctgagcctctgaccgtgacggcaccatccctaaccattgccgagaacatg
gccgacctgattgatggatactgccggctggtgaatggagccacacaatctttcatcatc
agaccccagaaagaaggtgaacgggcgttgccatcaataccaaagttggccaacagtgaa
aagcaaggcatgcggacacatgcagtctctgtgtcagagacagatgactatgcagagatc
atcgatgaggaagacacatacaccatgccctcgaccagggattatgagattcagagagaa
agaatagaacttggacgctgtattggagaaggtcagtttggagatgtacatcaaggcgtg
tacctgagcccagagaatccagctttggctgttgcaatcaaaacatgtaaaaactgtact
tcggacagcgtgagagagaagttccttcaagaagccttaacaatgcgtcagtttgaccat
cctcacatcgtgaagctgattggagtcattacagagaaccctgtctggataatcatggag
ttgtgcacacttggagagctgaggtcatttttgcaagtaagaaaatacagcttggacctg
gcatctttgatattatatgcctatcagcttagtacagcactcgcgtatctggagagcaaa
agatttgttcacagggacattgctgctcggaatgttctggtgtcttcaaatgattgtgta
aaattgggagactttggattatctcgatatatggaagacagtacttactataaagcttcc
aaaggaaaattacctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtgtggatgtttggtgtgtgtatgtgggagatactgatgcatggcgtg
aagccttttcaaggagtgaagaacaatgatgtgatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcccaccctctacagccttatgacgaaatgttgggcc
tatgaccccagcaggcggcccaggtttactgaactaaaagctcagctcagcacaatcctg
gaggaggagaaggtgcagcaagaagaacggatgaggatggaatccagaagacaggctacc
gtgtcctgggactctggagggtctgatgaagcaccacccaagcccagcagacctggttat
cctagcccgagatccagtgaaggattttatcccagcccacagcacatggtccagaccaat
cactaccaggtctctggctacccgggttcccatggaatcccagccatggctggcagcatt
taccaaggtcaggcatctcttctggaccagacagaattgtggaatcacagacctcaggag
atgtccatgtggcagcccagtgtggaggattcggcagctttggaccttcgagggatggga
caggtgcttccccctcacctgatggaagagcggctaatccgacagcagcaggaaatggaa
gaagaccagcgctggctggagaaggaagagcgattcctgaaacctgatgtgaggctctct
cgaggcagcatcgacagggaagacgggagttttcagggtccgactggaaaccaacacatc
tatcagcctgtggggaagccagatcctgcagctccaccaaagaaacctcctcgccctgga
gcacctggccacctaagcaacctgtccagcatcagcagccctgcagacagctacaatgag
ggtgtcaagcttcagccccaggaaatcagcccccctcccactgccaaccttgaccggtcc
aatgacaaggtatatgaaaatgtgacaggcctagtgaaggctgtcatcgagatgtccagc
aaaatccagccagctcctccagaagagtacgtccctatggtgaaggaagttggcctggcc
ctgcggaccttactagccacggtggatgagaccattcctgctcttccagccagcactcat
cgagagatcgagatggcacagaagctgctgaactccgacttaggcgagctcatcagcaag
atgaagctggcgcagcagtacgtcatgaccagcctgcagcaggagtataagaagcagatg
ctgacagctgctcacgccctggctgtggatgccaagaacctacttgatgttattgatcaa
gcaagactgaaaatgctagggcagacacggccacactga

DBGET integrated database retrieval system