KEGG   Mus musculus (mouse): 14164
Entry
14164             CDS       T01002                                 

Gene name
Fgf1, Dffrx, Fam, Fgf, Fgf-1, Fgfa
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14164 (Fgf1)
   04014 Ras signaling pathway
    14164 (Fgf1)
   04015 Rap1 signaling pathway
    14164 (Fgf1)
   04390 Hippo signaling pathway
    14164 (Fgf1)
   04151 PI3K-Akt signaling pathway
    14164 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14164 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14164 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    14164 (Fgf1)
   05218 Melanoma
    14164 (Fgf1)
   05224 Breast cancer
    14164 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14164 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14164 (Fgf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14164 (Fgf1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   14164 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14164
NCBI-ProteinID: NP_034327
MGI: 95515
Ensembl: ENSMUSG00000036585
Vega: OTTMUSG00000020317
UniProt: P61148 Q6ZWS1
LinkDB
Position
18 B3; 18 20.74 cM
AA seq 155 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcgcagccctgaccgagaggttcaacctgcctcta
ggaaactacaaaaagcccaaactgctctactgcagcaacgggggccacttcttgaggatc
cttcctgatggcaccgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagtgcgggcgaagtgtatataaagggtacggagaccggccagtacttg
gccatggacaccgaagggcttttatacggctcgcagacaccaaatgaggaatgtctgttc
ctggaaaggctggaagaaaaccattataacacttacacctccaagaagcatgcggagaag
aactggtttgtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactat
ggccagaaagccatcttgtttctgcccctcccggtgtcttctgactag

DBGET integrated database retrieval system