KEGG   Mus musculus (mouse): 14173Help
Entry
14173             CDS       T01002                                 

Gene name
Fgf2, Fgf-2, Fgfb, bFGF
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14173 (Fgf2)
   04015 Rap1 signaling pathway
    14173 (Fgf2)
   04010 MAPK signaling pathway
    14173 (Fgf2)
   04151 PI3K-Akt signaling pathway
    14173 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14173 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14173 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14173 (Fgf2)
   05205 Proteoglycans in cancer
    14173 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14173 (Fgf2)
   05218 Melanoma
    14173 (Fgf2)
   05224 Breast cancer
    14173 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14173 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14173 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14173 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14173 (Fgf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14173 (Fgf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   14173 (Fgf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF Fascin IL1
Motif
Other DBs
NCBI-GeneID: 14173
NCBI-ProteinID: NP_032032
MGI: 95516
Ensembl: ENSMUSG00000037225
Vega: OTTMUSG00000007393
UniProt: P15655 Q541T2
LinkDB All DBs
Position
3 B; 3 18.41 cM
AA seq 154 aa AA seqDB search
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagcggcatcacctcgcttcccgcactgccggaggacggcggcgccgccttc
ccaccaggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttcctg
cgcatccatcccgacggccgcgtggatggcgtccgcgagaagagcgacccacacgtcaaa
ctacaactccaagcagaagagagaggagttgtgtctatcaagggagtgtgtgccaaccgg
taccttgctatgaaggaagatggacggctgctggcttctaagtgtgttacagaagagtgt
ttcttctttgaacgactggaatctaataactacaatacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system