KEGG   Mus musculus (mouse): 14182Help
Entry
14182             CDS       T01002                                 

Gene name
Fgfr1, AW208770, Eask, FGFR-I, FLG, Fgfr-1, Flt-2, Fr1, Hspy, MFR, bFGF-R-1, c-fgr
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14182 (Fgfr1)
   04015 Rap1 signaling pathway
    14182 (Fgfr1)
   04010 MAPK signaling pathway
    14182 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    14182 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    14182 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    14182 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14182 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    14182 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    14182 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14182 (Fgfr1)
   05205 Proteoglycans in cancer
    14182 (Fgfr1)
   05230 Central carbon metabolism in cancer
    14182 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    14182 (Fgfr1)
   05215 Prostate cancer
    14182 (Fgfr1)
   05224 Breast cancer
    14182 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14182 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14182 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14182 (Fgfr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14182 (Fgfr1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14182 (Fgfr1)
CD molecules [BR:mmu04090]
 Proteins
  14182 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   14182 (Fgfr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Ig_4 Pkinase_fungal DUF4611 Kinase-like DUF1615
Motif
Other DBs
NCBI-GeneID: 14182
NCBI-ProteinID: NP_034336
MGI: 95522
Ensembl: ENSMUSG00000031565
Vega: OTTMUSG00000031031
UniProt: P16092 Q8CBY7
LinkDB All DBs
Structure
PDB: 

Position
8 A2; 8 14.12 cM
AA seq 822 aa AA seqDB search
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggggctggaagtgcctcctcttctgggctgtgctggtcacagccactctctgcact
gccaggccagccccaaccttgcctgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccccgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcctcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcatgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagtttaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgacgtcgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagctgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgcatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcagctgactccagtgcatccatgaactctggg
gttctcctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtc
tccgaatatgagctccctgaggatccccgctgggagctgccacgagacagactggtctta
ggcaaaccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctg
gataaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgttgaagtccgacgca
acggagaaggacctgtcggatctgatctcggagatggagatgatgaaaatgattgggaag
cacaagaatatcatcaaccttctgggagcgtgcacacaggatggtcctctttatgtcatt
gtggagtacgcctccaaaggcaatctccgggagtatctacaggcccggaggcctcctggg
ctggagtactgctataaccccagccacaaccccgaggaacagctgtcttccaaagatctg
gtatcctgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtata
caccgagacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgca
gactttggcttagctcgagacattcatcatatcgactactacaagaaaaccaccaacggc
cggctgcctgtgaagtggatggcccctgaggcgttgtttgaccggatctacacacaccag
agcgatgtgtggtcttttggagtgctcttgtgggagatcttcactctgggtggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctctcagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttg
acctccaaccaggagtatctggacctgtccataccgctggaccagtactcacccagcttt
cccgacacacggagctccacctgctcctcaggggaggactctgtcttctctcatgagccg
ttacctgaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaa
cggcgctga

KEGG   Mus musculus (mouse): 14183Help
Entry
14183             CDS       T01002                                 

Gene name
Fgfr2, AU043015, AW556123, Bek, Fgfr-2, Fgfr-7, Fgfr7, KGFR, KGFRTr, svs
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14183 (Fgfr2)
   04015 Rap1 signaling pathway
    14183 (Fgfr2)
   04010 MAPK signaling pathway
    14183 (Fgfr2)
   04151 PI3K-Akt signaling pathway
    14183 (Fgfr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14183 (Fgfr2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14183 (Fgfr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14183 (Fgfr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14183 (Fgfr2)
   05230 Central carbon metabolism in cancer
    14183 (Fgfr2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14183 (Fgfr2)
   05215 Prostate cancer
    14183 (Fgfr2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14183 (Fgfr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14183 (Fgfr2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14183 (Fgfr2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14183 (Fgfr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14183 (Fgfr2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14183 (Fgfr2)
CD molecules [BR:mmu04090]
 Proteins
  14183 (Fgfr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   14183 (Fgfr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM Ig_5 Ig_4 C2-set_2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 14183
NCBI-ProteinID: NP_034337
MGI: 95523
Ensembl: ENSMUSG00000030849
Vega: OTTMUSG00000031222
UniProt: P21803 E9QK53
LinkDB All DBs
Structure
PDB: 

Position
7; 7 F3
AA seq 840 aa AA seqDB search
MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARTVDSETWYFMVNVTDAISSGDDEDDTDSSEDVVSENRSNQRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYT
CLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMK
TTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLA
GVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKD
DATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRP
PGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMK
IADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGG
SPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL
TLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgggattaccgtccacgtggagatatggaagaggaccagggattggcactgtgaccatg
gtcagctgggggcgcttcatctgcctggtcttggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaggataccactttagaaccagaagagccaccaaccaaa
taccaaatctcccaaccagaagcgtacgtggttgcccccggggaatcgctagagttgcag
tgcatgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtatctccagataaaaggtgccacacctagagac
tccggcctctatgcttgtactgcagctaggacggtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatctggagatgatgaggacgacacagatagctccgaa
gacgttgtcagtgagaacaggagcaaccagagagcaccgtactggaccaacaccgagaag
atggagaagcggctccacgctgtccctgccgccaacactgtgaagttccgctgtccggct
ggggggaatccaacgcccacaatgaggtggttaaaaaacgggaaggagtttaagcaggag
catcgcattggaggctataaggtacgaaaccagcactggagccttattatggaaagtgtg
gtcccgtcagacaaaggcaactacacctgcctggtggagaatgaatacgggtccatcaac
cacacctaccacctcgatgtcgttgaacggtcaccacaccggcccatcctccaagctgga
ctgcctgcaaatgcctccacggtggtcggaggggatgtggagtttgtctgcaaggtttac
agcgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcctgatgggctgccctacctcaaggtcctgaaggccgccggtgttaacaccacggac
aaagagattgaggttctctatattcggaatgtaacttttgaggatgctggggaatatacg
tgcttggcgggtaattctatcgggatatcctttcactctgcatggttgacagttctgcca
gcgcctgtgagagagaaggagatcacggcttccccagattatctggagatagctatttac
tgcataggggtcttcttaatcgcctgcatggtggtgacagtcatcttttgccgaatgaag
accacgaccaagaagccagacttcagcagccagccagctgtgcacaagctgaccaagcgc
atccccctgcggagacaggtaacagtttcggccgagtccagctcctccatgaactccaac
accccgctggtgaggataacaacgcgtctgtcctcaacagcggacaccccgatgctagca
ggggtctccgagtatgagttgccagaggatccaaagtgggaattccccagagataagctg
acgctgggcaaacccctgggggaaggttgcttcgggcaagtagtcatggctgaagcagtg
ggaatcgataaagacaaacccaaggaggcggtcaccgtggcagtgaagatgttgaaagat
gatgccacagagaaggacctgtctgatctggtatcagagatggagatgatgaagatgatt
gggaaacataagaacattatcaacctcctgggggcctgcacgcaggatggacctctctac
gtcatagttgaatatgcatcgaaaggcaacctccgggaatacctccgagcccggaggcca
cctggcatggagtactcctatgacattaaccgtgtccccgaggagcagatgaccttcaag
gacttggtgtcctgcacctaccagctggctagaggcatggagtacttggcttcccaaaaa
tgtatccatcgagatttggctgccagaaacgtgttggtaacagaaaacaatgtgatgaag
atagcagactttggcctggccagggatatcaacaacatagactactataaaaagaccaca
aatgggcgacttccagtcaagtggatggctcctgaagccctttttgatagagtttacact
catcagagcgatgtctggtccttcggggtgttaatgtgggagatctttactttagggggc
tcaccctacccagggattcccgtggaggaactttttaagctgctcaaagagggacacagg
atggacaagcccaccaactgcaccaatgaactgtacatgatgatgagggattgctggcat
gctgtaccctcacagagacccacattcaagcagttggtcgaagacttggatcgaattctg
actctcacaaccaatgaggaatacttggatctcacccagcctctcgaacagtattctcct
agttaccccgacacaaggagctcttgttcttcaggggacgattctgtgttttctccagac
cccatgccttatgaaccctgtctgcctcagtatccacacataaacggcagtgttaaaaca
tga

KEGG   Mus musculus (mouse): 14184Help
Entry
14184             CDS       T01002                                 

Gene name
Fgfr3, CD333, FR3, Fgfr-3, Flg-2, HBGFR, Mfr3, sam3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14184 (Fgfr3)
   04015 Rap1 signaling pathway
    14184 (Fgfr3)
   04010 MAPK signaling pathway
    14184 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    14184 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14184 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14184 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14184 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14184 (Fgfr3)
   05206 MicroRNAs in cancer
    14184 (Fgfr3)
   05230 Central carbon metabolism in cancer
    14184 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    14184 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14184 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14184 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14184 (Fgfr3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14184 (Fgfr3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14184 (Fgfr3)
CD molecules [BR:mmu04090]
 Proteins
  14184 (Fgfr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Kinase-like Pkinase_fungal DUF1533 RIO1
Motif
Other DBs
NCBI-GeneID: 14184
NCBI-ProteinID: NP_001156687
MGI: 95524
Ensembl: ENSMUSG00000054252
Vega: OTTMUSG00000021524
UniProt: Q7TSI8
LinkDB All DBs
Position
5 B2; 5 17.83 cM
AA seq 800 aa AA seqDB search
MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCH
PPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFS
VRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSI
SWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYV
TVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMET
DEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLE
SNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQV
VMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACT
QGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGME
YLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEAL
FDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMI
MRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDD
SVFTHDLLPPGPPSNGGPRT
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcccggcctgcgtgctagtgttctgcgtggcggtcgtggctggagctacttcc
gagcctcctggtccagagcagcgagttgtgcggagagcggcagaggttccagggcctgaa
cctagccagcaggagcaggtggccttcggcagtggggacaccgtggagctgagctgccat
cctcctggaggtgcccccacagggcccacggtctgggctaaggatggtacaggtctggtg
gcctcccaccgcatcctggtggggcctcagaggctgcaagtgctaaatgcctcccacgaa
gatgcaggggtctacagctgccagcaccggctcactcggcgtgtgctgtgccacttcagt
gtgcgtgtaacagatgctccatcctcaggagatgacgaagatggggaggacgtggctgaa
gacacaggggctccttattggactcgcccggagcgaatggataagaaactgctggctgtg
ccagccgcaaacactgtccgcttccgctgcccagctgctggcaaccctaccccctccatc
tcctggctgaagaatggcaaagaattccgaggggagcatcgcattgggggcatcaagctc
cggcaccagcagtggagcttggtcatggaaagtgtggtaccctccgatcgtggcaactat
acctgtgtagttgagaacaagtttggcagcatccggcagacatacacactggatgtgctg
gagcgctccccacaccggcccatcctgcaggctgggctgccggccaaccagacagccatt
ctaggcagtgacgtggagttccactgcaaggtgtacagcgatgcacagccacacatccag
tggctgaagcacgtggaagtgaacggcagcaaggtgggccctgacggcacgccctacgtc
actgtactcaagactgcaggcgctaacaccaccgacaaggagctagaggttctgtccttg
cacaatgtcacctttgaggacgcgggggagtacacctgcctggcgggcaattctattggg
ttttcccatcactctgcgtggctggtggtgctgccagctgaggaggagctgatggaaact
gatgaggctggcagcgtgtacgcaggcgtcctcagctacggggtggtcttcttcctcttc
atcctggtggtggcagctgtgatactctgccgcctgcgcagtcccccaaagaagggcttg
ggctcgcccaccgtgcacaaggtctctcgcttcccgcttaagcgacaggtgtccttggaa
tctaactcctctatgaactccaacacaccccttgtccggattgcccggctgtcctcagga
gaaggtcctgttctggccaatgtttctgaacttgagctgcctgctgaccccaagtgggag
ctatccaggacccggctgacacttggtaagcctcttggagaaggctgctttggacaggtg
gtcatggcagaagctattggcatcgacaaggaccgtactgccaagcctgtcaccgtggcc
gtgaagatgctgaaagatgatgcgactgacaaggacctgtcggacctggtatctgagatg
gagatgatgaaaatgattggcaagcacaagaacatcattaacctgctgggggcgtgcaca
cagggtgggcccctgtatgtgctggtggagtacgcagccaagggcaatctccgggagttc
cttcgggcgcggcggcctccaggcatggactactcctttgatgcctgcaggctgccagag
gaacagctcacctgcaaggatctagtgtcctgtgcctaccaggtggcacggggcatggaa
tacttggcttctcagaagtgtattcacagagacttggctgccagaaacgtcctggtgacc
gaggacaatgtgatgaagattgcggactttggcctggctcgagatgtgcacaacctggac
tactacaagaagaccacaaatggccggctacctgtgaagtggatggcaccagaggccctt
tttgaccgagtctacacccaccagagtgatgtttggtcttttggtgtcctcctctgggag
atctttacgctggggggctcaccgtatcctggcatcccagtggaagagcttttcaagctg
ttgaaagagggccaccgcatggacaagccagccagctgcacacatgacctgtacatgatc
atgcgggaatgttggcatgcggtgccttcacagaggcccaccttcaagcagttggtagag
gatttagaccgcatcctcactgtgacatcaaccgacgagtacttggacctctccgtgccg
tttgagcagtactcgccaggtggccaggacacgcctagctccagctcgtccggagatgac
tcggtgttcacccatgacctgctacccccaggtccacccagtaacgggggacctcggacg
tga

KEGG   Mus musculus (mouse): 14186Help
Entry
14186             CDS       T01002                                 

Gene name
Fgfr4, Fgfr-4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14186 (Fgfr4)
   04015 Rap1 signaling pathway
    14186 (Fgfr4)
   04010 MAPK signaling pathway
    14186 (Fgfr4)
   04151 PI3K-Akt signaling pathway
    14186 (Fgfr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14186 (Fgfr4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14186 (Fgfr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14186 (Fgfr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14186 (Fgfr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14186 (Fgfr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14186 (Fgfr4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14186 (Fgfr4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14186 (Fgfr4)
CD molecules [BR:mmu04090]
 Proteins
  14186 (Fgfr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set Ig_2 ig V-set Ig_5 Kinase-like C2-set_2
Motif
Other DBs
NCBI-GeneID: 14186
NCBI-ProteinID: NP_032037
MGI: 95525
Ensembl: ENSMUSG00000005320
Vega: OTTMUSG00000035043
UniProt: Q03142 A0A0R4IZY3
LinkDB All DBs
Position
13 B1; 13 29.8 cM
AA seq 799 aa AA seqDB search
MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERG
RHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTS
ISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIH
WLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLE
RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQ
VLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATP
EARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESR
SSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVR
AEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQE
GPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYL
ESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFD
RVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMR
ECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFS
HDPLPLEPSPFPFSDSQTT
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctcttggccctgttgagcatctttcaggggacaccagctttgtcccttgag
gcctctgaggaaatggagcaggagccctgcctagccccaatcctggagcagcaagagcag
gtgttgacggtggccctggggcagcctgtgaggctgtgctgtgggcgcaccgagcgtggt
cgtcactggtacaaagagggcagccgcctagcatctgctgggcgagtacggggttggaga
ggccgcctggagatcgccagcttccttcctgaggatgctggccgatacctctgcctggcc
cgtggctccatgaccgtcgtacacaatcttacgttgcttatggatgactccttaacctcc
atcagtaatgatgaagaccccaagacactcagcagctcctcgagtggtcatgtctaccca
cagcaagcaccctactggacacacccccaacgcatggagaagaaactgcatgcagtgcct
gccgggaatactgtcaaattccgctgtccagctgcagggaaccccatgcctaccatccac
tggctcaaggatggacaggccttccacggggagaatcgtattggaggcattcggctgcgc
caccaacactggagcctggtgatggaaagtgtggtaccctcggaccgtggcacatacaca
tgccttgtggagaactctctgggtagcattcgctacagctatctcctggatgtgctggag
cggtccccgcaccggcccatcctgcaggcggggctcccagccaacaccacagctgtggtt
ggcagcgatgtggagctactctgcaaggtgtacagcgacgcccagccccacatacagtgg
ctgaaacacgtcgtcatcaacggcagcagcttcggcgccgacggtttcccctacgtacaa
gtcctgaagacaacagacatcaatagctcggaggtagaggtcttgtatctgaggaacgtg
tccgctgaggatgcaggagagtatacctgtctggcgggcaactccatcggcctttcctac
cagtcagcgtggctcacggtgctgccagaggaagacctcacgtggacaacagcaacccct
gaggccagatacacagatatcatcctgtatgtatcaggctcactggttctgcttgtgctc
ctgctgctggccggggtgtatcatcggcaagtcatccgtggccactactctcgccagcct
gtcactatacaaaagctgtcccgtttccctttggcccgacagttctctttggagtcgagg
tcctctggcaagtcaagtttgtccctggtgcgaggtgtccgtctctcctccagcggcccg
cccttgctcacgggccttgtgaatctagacctgcctctcgatccgctttgggaattcccc
cgggacaggttggtgctcggaaagcccctgggtgagggctgctttgggcaagtggttcgt
gcagaggcctttggtatggatccctcccggcccgaccaaaccagcaccgtggctgtgaag
atgctgaaagacaatgcctccgacaaggatttggcagacctggtctccgagatggaggtg
atgaagctaatcggaagacacaagaacatcatcaacctgctgggtgtctgcactcaggaa
gggcccctgtacgtgattgtggaatgtgccgccaagggaaaccttcgggaattcctccgt
gcccggcgccccccaggccctgatctcagccctgatggacctcggagcagcgaaggacca
ctctccttcccggccctagtctcctgtgcctaccaggtggcccgaggcatgcagtatctg
gagtctcggaagtgcatccaccgggacctggctgcccgaaatgtgctggtgaccgaggat
gatgtgatgaagatcgctgactttgggctggcacgtggtgtccaccacattgactactat
aagaaaaccagcaacggccgcctgccagtcaaatggatggctccagaggcattgttcgac
cgcgtgtacacacaccagagtgacgtgtggtctttcgggatcctgctgtgggaaatcttc
accctcgggggctccccataccctggcattccggtggaggagctcttctcactgctgcga
gaggggcacaggatggagcggcccccaaactgcccctcagagctgtatgggctaatgagg
gagtgctggcacgcagccccatctcagaggcctacttttaagcagctggtggaagctctg
gacaaggtcctgctggctgtctctgaagagtaccttgacctccgcctgacctttggaccc
ttttctccctccaatggggatgccagcagcacctgctcctccagtgactcggttttcagc
cacgaccctttgcccctcgagccaagccccttccctttctctgactcgcagacgacatga

DBGET integrated database retrieval system