KEGG   Mus musculus (mouse): 14194Help
Entry
14194             CDS       T01002                                 

Gene name
Fh1, Fh, Fh-1
Definition
(RefSeq) fumarate hydratase 1
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00020  Citrate cycle (TCA cycle)
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
mmu05211  Renal cell carcinoma
Module
mmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    14194 (Fh1)
   00620 Pyruvate metabolism
    14194 (Fh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14194 (Fh1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    14194 (Fh1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14194 (Fh1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     14194 (Fh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-GeneID: 14194
NCBI-ProteinID: NP_034339
MGI: 95530
Ensembl: ENSMUSG00000026526
Vega: OTTMUSG00000025588
UniProt: P97807
LinkDB All DBs
Position
1; 1 H3
AA seq 507 aa AA seqDB search
MYRALRLLARSRRLLRVPSAGAAVSGEATTLPRCAPNVARMASQNSFRVEFDTFGELKVP
TDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAAAEVNQEYGLDPKIASAIMKA
ADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNK
SQSSNDTFPTAMHIAAAVEVHKVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLT
LGQEFSGYVQQVQYAMVRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGL
PFVTAPNKFEALAAHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEP
GSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLL
GDASVSFTDNCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLK
ETAIELGYLTAEQFDEWVKPKDMLGPK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcactccgtctcctcgcgcgctcgcgtcgcctcctgcgggttccgtccgcc
ggtgctgcagtgtctggggaagcgaccaccctcccgcggtgtgctccgaacgtcgcgcga
atggcaagccaaaattccttccgtgtagagttcgacacctttggtgaattgaaggttcca
accgataagtattatggtgctcagaccgtaagatctacgatgaactttaagattggaggt
gctacggaacgtatgccaatcccagtcattcaagctttcggcatcttgaagcgagctgct
gctgaagtaaaccaggagtatggtctcgatccaaagattgctagtgcaataatgaaggcc
gcagatgaggtagctgaaggtaaattaaatgatcactttcctctggtggtttggcagact
ggatcaggaacccagacaaacatgaatgtaaatgaagtcattagcaacagagcaattgaa
atgttaggaggtgaacttggcagcaagaagcctgtgcaccccaatgatcatgttaacaaa
agccagagctcgaatgacacctttcccacagcaatgcatattgctgctgcagtggaagtt
cacaaggtcctgttgccagggttacagaagctccatgatgctctcagtgcaaaatccaaa
gagtttgcgcaggtcatcaaaattgggcgaactcacacgcaggatgctgtccctcttact
cttggacaggaattcagtggttacgttcagcaagtccagtatgcgatggtgagaataaaa
gccgccatgccaagaatctacgagctcgctgctggaggcactgctgtggggacggggtta
aacaccaggatcggtttcgcagaaaaggtggccgcaaaagtagcagcactcacaggtttg
ccttttgtcactgccccgaataagtttgaagctctggctgctcatgatgctctggttgag
cttagtggagccatgaacactgccgcctgcagtctaatgaagatagcgaatgatattcgc
ttcctgggttctggtcctcggtcaggtttgggagagctgatcttgcctgaaaacgagcca
gggagcagcatcatgccaggaaaggtgaaccctactcagtgtgaagcgatgaccatggtt
gcagcccaagtcatggggaatcacgttgctgttaccgttggaggcagcaatggacatttt
gaactgaatgtgtttaaaccaatgatgattaagaatgtgctgcactcagccaggctactg
ggagatgcttcagtgtccttcacagacaactgtgtggtcgggatccaggccaacacagag
cggatcaacaagctaatgaatgagtctttaatgttggtcacagctcttaatccacatata
gggtatgacaaagcagcaaagattgccaagaccgcacacaagaacggatcaaccttaaag
gaaacggctattgaacttggctatctcacagcagagcagtttgatgagtgggtgaaaccc
aaggatatgctgggtccaaagtga

DBGET integrated database retrieval system