KEGG   Mus musculus (mouse): 14205Help
Entry
14205             CDS       T01002                                 

Gene name
Vegfd, AI325264, Figf, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14205 (Vegfd)
   04015 Rap1 signaling pathway
    14205 (Vegfd)
   04010 MAPK signaling pathway
    14205 (Vegfd)
   04668 TNF signaling pathway
    14205 (Vegfd)
   04151 PI3K-Akt signaling pathway
    14205 (Vegfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14205 (Vegfd)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14205 (Vegfd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14205 (Vegfd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14205 (Vegfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14205 (Vegfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14205 (Vegfd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF CXCXC
Motif
Other DBs
NCBI-GeneID: 14205
NCBI-ProteinID: NP_034346
MGI: 108037
Ensembl: ENSMUSG00000031380
Vega: OTTMUSG00000019516
UniProt: P97946
LinkDB All DBs
Position
X F5; X 76.35 cM
AA seq 358 aa AA seqDB search
MYGEWGMGNILMMFHVYLVQGFRSEHGPVKDFSFERSSRSMLERSEQQIRAASSLEELLQ
IAHSEDWKLWRCRLKLKSLASMDSRSASHRSTRFAATFYDTETLKVIDEEWQRTQCSPRE
TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSV
PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCPIDMLWDNTKCKC
VLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGDLIQHPENCSCFECKE
SLESCCQKHKIFHPDTCSCEDRCPFHTRTCASRKPACGKHWRFPKETRAQGLYSQENP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtatggagaatggggaatggggaatatcctcatgatgttccatgtgtacttggtgcag
ggcttcaggagcgaacatggaccagtgaaggatttttcttttgagcgatcatcccggtcc
atgttggaacgatctgaacaacagatccgagcagcttctagtttggaggagttgctgcaa
atcgcgcactctgaggactggaagctgtggcgatgccggttgaagctcaaaagtcttgcc
agtatggactcacgctcagcatcccatcgctccaccagatttgcggcaactttctatgac
actgaaacactaaaagttatagatgaagaatggcagaggacccaatgcagccctagagag
acatgcgtagaagtcgccagtgagctggggaagacaaccaacacattcttcaagcccccc
tgtgtaaatgtcttccggtgtggaggctgctgcaacgaagagggtgtgatgtgtatgaac
acaagcacctcctacatctccaaacagctctttgagatatcagtgcctctgacatcagtg
cccgagttagtgcctgttaaaattgccaaccatacgggttgtaagtgcttgcccacgggc
ccccgccatccttactcaattatcagaagatccattcagaccccagaagaagatgaatgt
cctcattccaagaaactctgtcctattgacatgctgtgggataacaccaaatgtaaatgt
gttttgcaagacgagactccactgcctgggacagaagaccactcttacctccaggaaccc
actctctgtggaccgcacatgacgtttgatgaagatcgctgtgagtgcgtctgtaaagca
ccatgtccgggagatctcattcagcacccggaaaactgcagttgctttgagtgcaaagaa
agtctggagagctgctgccaaaagcacaagatttttcacccagacacctgcagctgtgag
gacagatgtccttttcacaccagaacatgtgcaagtagaaagccagcctgtggaaagcac
tggcgctttccaaaggagacaagggcccagggactctacagccaggagaacccttga

KEGG   Mus musculus (mouse): 18654Help
Entry
18654             CDS       T01002                                 

Gene name
Pgf, AI854365, PIGF, Plgf
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18654 (Pgf)
   04015 Rap1 signaling pathway
    18654 (Pgf)
   04010 MAPK signaling pathway
    18654 (Pgf)
   04151 PI3K-Akt signaling pathway
    18654 (Pgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18654 (Pgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18654 (Pgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18654 (Pgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18654 (Pgf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 18654
NCBI-ProteinID: NP_032853
MGI: 105095
Ensembl: ENSMUSG00000004791
UniProt: P49764 Q544A5
LinkDB All DBs
Position
12 D1; 12 39.58 cM
AA seq 158 aa AA seqDB search
MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDE
YPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatgaagctgttcacttgcttcttacaggtcctagctgggttggctgtgcat
tcccagggggccctgtctgctgggaacaactcaacagaagtggaagtggtgcctttcaac
gaagtgtggggtcgcagctactgtcggcccatggagaagctggtgtacatcttggatgaa
taccctgatgaggtgtctcacatattcagtccgtcctgtgtccttctgagtcgctgtagt
ggctgctgtggtgatgaaggtctgcactgtgtgccgataaagacagccaacatcactatg
cagatcttgaagattccccccaatcgggatccacatttctatgtggagatgacattttct
caggatgtgctctgtgaatgcagacctattctggagacgacaaaggcagaaaggaggaaa
accaaggggaagaggaagaggagtagaaactcacagactgaggaaccccacccgtga

KEGG   Mus musculus (mouse): 22339Help
Entry
22339             CDS       T01002                                 

Gene name
Vegfa, Vegf, Vpf
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22339 (Vegfa)
   04015 Rap1 signaling pathway
    22339 (Vegfa)
   04010 MAPK signaling pathway
    22339 (Vegfa)
   04370 VEGF signaling pathway
    22339 (Vegfa)
   04066 HIF-1 signaling pathway
    22339 (Vegfa)
   04151 PI3K-Akt signaling pathway
    22339 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22339 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22339 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22339 (Vegfa)
   05206 MicroRNAs in cancer
    22339 (Vegfa)
   05205 Proteoglycans in cancer
    22339 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    22339 (Vegfa)
   05211 Renal cell carcinoma
    22339 (Vegfa)
   05219 Bladder cancer
    22339 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    22339 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22339 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22339 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    22339 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22339 (Vegfa)
   05165 Human papillomavirus infection
    22339 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    22339 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22339 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22339 (Vegfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22339 (Vegfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   22339 (Vegfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VEGF_C PDGF Cnd1_N
Motif
Other DBs
NCBI-GeneID: 22339
NCBI-ProteinID: NP_001273985
MGI: 103178
Ensembl: ENSMUSG00000023951
Vega: OTTMUSG00000016285
UniProt: Q00731
LinkDB All DBs
Position
17 C; 17 22.79 cM
AA seq 214 aa AA seqDB search
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggagagcagaagtcccatgaagtgatc
aagttcatggatgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgcgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagacagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

KEGG   Mus musculus (mouse): 22340Help
Entry
22340             CDS       T01002                                 

Gene name
Vegfb, VEGF-B, Vrf
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22340 (Vegfb)
   04015 Rap1 signaling pathway
    22340 (Vegfb)
   04010 MAPK signaling pathway
    22340 (Vegfb)
   04151 PI3K-Akt signaling pathway
    22340 (Vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22340 (Vegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22340 (Vegfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22340 (Vegfb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22340 (Vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22340 (Vegfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22340 (Vegfb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF
Motif
Other DBs
NCBI-GeneID: 22340
NCBI-ProteinID: NP_035827
MGI: 106199
Ensembl: ENSMUSG00000024962
Vega: OTTMUSG00000033015
UniProt: P49766
LinkDB All DBs
Position
19; 19 A
AA seq 207 aa AA seqDB search
MSPLLRRLLLVALLQLARTQAPVSQFDGPSHQKKVVPWIDVYARATCQPREVVVPLSMEL
MGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIQYPSSQLGEMSLEEHS
QCECRPKKKESAVKPDRVAIPHHRPQPRSVPGWDSTPGASSPADIIHPTPAPGSSARLAP
SAVNALTPGPAAAAADAAASSIAKGGA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagccccctgctccgtcgcctgctgcttgttgcactgctgcagctggctcgcacccag
gcccctgtgtcccagtttgatggccccagccaccagaagaaagtggtgccatggatagac
gtttatgcacgtgccacatgccagcccagggaggtggtggtgcctctgagcatggaactc
atgggcaatgtggtcaaacaactagtgcccagctgtgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggaatgtgtgcccactgggcaacaccaagtccgaatgcag
atcctcatgatccagtacccgagcagtcagctgggggagatgtccctggaagaacacagc
caatgtgaatgcagaccaaaaaaaaaggagagtgctgtgaagccagacagggttgccata
ccccaccaccgtccccagccccgctctgttccgggctgggactctaccccgggagcatcc
tccccagctgacatcatccatcccactccagccccaggatcctctgcccgccttgcaccc
agcgccgtcaacgccctgacccccggacctgccgctgccgctgcagacgccgccgcttcc
tccattgccaagggcggggcttag

KEGG   Mus musculus (mouse): 22341Help
Entry
22341             CDS       T01002                                 

Gene name
Vegfc, AW228853, VEGF-C
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    22341 (Vegfc)
   04015 Rap1 signaling pathway
    22341 (Vegfc)
   04010 MAPK signaling pathway
    22341 (Vegfc)
   04668 TNF signaling pathway
    22341 (Vegfc)
   04151 PI3K-Akt signaling pathway
    22341 (Vegfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22341 (Vegfc)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22341 (Vegfc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22341 (Vegfc)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22341 (Vegfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22341 (Vegfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22341 (Vegfc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF CXCXC
Motif
Other DBs
NCBI-GeneID: 22341
NCBI-ProteinID: NP_033532
MGI: 109124
Ensembl: ENSMUSG00000031520
Vega: OTTMUSG00000060617
UniProt: P97953
LinkDB All DBs
Position
8; 8 B1.3
AA seq 415 aa AA seqDB search
MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQL
RSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDN
EWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKT
LFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCP
TNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNKELDEDTCQCVCKGGLRPSSC
GPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTE
NTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcacttgctgtgcttcttgtctctggcgtgttccctgctcgccgctgcgctgatcccc
agtccgcgcgaggcgcccgccaccgtcgccgccttcgagtcgggactgggcttctcggaa
gcggagcccgacgggggcgaggtcaaggcttttgaaggcaaagacctggaggagcagttg
cggtctgtgtccagcgtagatgagctgatgtctgtcctgtacccagactactggaaaatg
tacaagtgccagctgcggaaaggcggctggcagcagcccaccctcaataccaggacaggg
gacagtgtaaaatttgctgctgcacattataacacagagatcctgaaaagtattgataat
gagtggagaaagactcaatgcatgccacgtgaggtgtgtatagatgtggggaaggagttt
ggagcagccacaaacaccttctttaaacctccatgtgtgtccgtctacagatgtgggggt
tgctgcaacagcgaggggctgcagtgcatgaacaccagcacaggttacctcagcaagacg
ttgtttgaaattacagtgcctctctcacaaggccccaaaccagtcacaatcagttttgcc
aatcacacttcctgccggtgcatgtctaaactggatgtttacagacaagttcattcaatt
attagacgttctctgccagcaacattaccacagtgtcaggcagctaacaagacatgtcca
acaaactatgtgtggaataactacatgtgccgatgcctggctcagcaggattttatcttt
tattcaaatgttgaagatgactcaaccaatggattccatgatgtctgtggacccaacaag
gagctggatgaagacacctgtcagtgtgtctgcaagggggggcttcggccatctagttgt
ggaccccacaaagaactagatagagactcatgtcagtgtgtctgtaaaaacaaacttttc
cctaattcatgtggagccaacagggaatttgatgagaatacatgtcagtgtgtatgtaaa
agaacgtgtccaagaaatcagcccctgaatcctgggaaatgtgcctgtgaatgtacagaa
aacacacagaagtgcttccttaaagggaagaagttccaccatcaaacatgcagttgttac
agaagaccgtgtgcgaatcgactgaagcattgtgatccaggactgtcctttagtgaagaa
gtatgccgctgtgtcccatcgtattggaaaaggccacatctgaactaa

DBGET integrated database retrieval system