KEGG   Mus musculus (mouse): 14254
Entry
14254             CDS       T01002                                 

Gene name
Flt1, AI323757, Flt-, Flt-1, VEGF, VEGFR, VEGFR-1, VEGFR1, sFl, sFlt1
Definition
(RefSeq) FMS-like tyrosine kinase 1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05202  Transcriptional misregulation in cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14254 (Flt1)
   04014 Ras signaling pathway
    14254 (Flt1)
   04015 Rap1 signaling pathway
    14254 (Flt1)
   04066 HIF-1 signaling pathway
    14254 (Flt1)
   04020 Calcium signaling pathway
    14254 (Flt1)
   04151 PI3K-Akt signaling pathway
    14254 (Flt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14254 (Flt1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    14254 (Flt1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14254 (Flt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14254 (Flt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14254 (Flt1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   14254 (Flt1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD Ig_6 C1-set Ig_4 Ig_5 Izumo-Ig Herpes_gE
Other DBs
NCBI-GeneID: 14254
NCBI-ProteinID: NP_034358
MGI: 95558
Ensembl: ENSMUSG00000029648
Vega: OTTMUSG00000021385
UniProt: P35969 A0A0R4J0A4
LinkDB
Position
5 G3; 5 87.01 cM
AA seq 1333 aa
MVSCWDTAVLPYALLGCLLLTGYGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKRLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKK
AESSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKKFPFDTLTP
DGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYLTHRQTNTILDVQIRPPSP
VRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVFHSVLKIN
NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKV
KAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLT
ATLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPCHHNHSKER
YDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVSTLVVADSQTPGIYSCRAFN
KIGTVERNIKFYVTDVPNGFHVSLEKMPAEGEDLKLSCVVNKFLYRDITWILLRTVNNRT
MHHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSE
APHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIE
RVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEVKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDS
VSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRRGDTRLPLKWMAPESIFDKVYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDCWHKD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTRNSGFTYSTPTFSEDLFKDGFAD
PHFHSGSSDDVRYVNAFKFMSLERIKTFEELSPNSTSMFEDYQLDTSTLLGSPLLKRFTW
TETKPKASMKIDLRIASKSKEAGLSDLPRPSFCFSSCGHIRPVQDDESELGKESCCSPPP
DYNSVVLYSSPPA
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggtcagctgctgggacaccgcggtcttgccttacgcgctgctcgggtgtctgcttctc
acaggatatggctcagggtcgaagttaaaagtgcctgaactgagtttaaaaggcacccag
catgtcatgcaagcaggccagactctctttctcaagtgcagaggggaggcagcccactca
tggtctctgcccacgaccgtgagccaggaggacaaaaggctgagcatcactcccccatcg
gcctgtgggagggataacaggcaattctgcagcaccttgaccttggacacggcgcaggcc
aaccacacgggcctctacacctgtagatacctccctacatctacttcgaagaaaaagaaa
gcggaatcttcaatctacatatttgttagtgatgcagggagtcctttcatagagatgcac
actgacatacccaaacttgtgcacatgacggaaggaagacagctcatcatcccctgccgg
gtgacgtcacccaacgtcacagtcaccctaaaaaagtttccatttgatactcttacccct
gatgggcaaagaataacatgggacagtaggagaggctttataatagcaaatgcaacgtac
aaagagataggactgctgaactgcgaagccaccgtcaacgggcacctgtaccagacaaac
tatctgacccatcggcagaccaatacaatcctagatgtccaaatacgcccgccgagccca
gtgagactgctccacgggcagactcttgtcctcaactgcaccgccaccacggagctcaat
acgagggtgcaaatgagctggaattaccctggtaaagcaactaagagagcatctataagg
cagcggattgaccggagccattcccacaacaatgtgttccacagtgttcttaagatcaac
aatgtggagagccgagacaaggggctctacacctgtcgcgtgaagagtgggtcctcgttc
cagtctttcaacacctccgtgcatgtgtatgaaaaaggattcatcagtgtgaaacatcgg
aagcagccggtgcaggaaaccacagcaggaagacggtcctatcggctgtccatgaaagtg
aaggccttcccctccccagaaatcgtatggttaaaagatggctcgcctgcaacattgaag
tctgctcgctatttggtacatggctactcattaattatcaaagatgtgacaaccgaggat
gcaggggactatacgatcttgctgggcataaagcagtcaaggctatttaaaaacctcact
gccactctcattgtaaacgtgaaacctcagatctacgaaaagtccgtgtcctcgcttcca
agcccacctctctatccgctgggcagcagacaagtcctcacttgcaccgtgtatggcatc
cctcggccaacaatcacgtggctctggcacccctgtcaccacaatcactccaaagaaagg
tatgacttctgcactgagaatgaagaatcctttatcctggatcccagcagcaacttagga
aacagaattgagagcatctctcagcgcatgacggtcatagaaggaacaaataagacggtt
agcacattggtggtggctgactctcagacccctggaatctacagctgccgggccttcaat
aaaatagggactgtggaaagaaacataaaattttatgtcacagatgtgccgaatggcttt
cacgtttccttggaaaagatgccagccgaaggagaggacctgaaactgtcctgtgtggtc
aataaattcctgtacagagacattacctggattctgctacggacagttaacaacagaacc
atgcaccatagtatcagcaagcaaaaaatggccaccactcaagattactccatcactctg
aaccttgtcatcaagaacgtgtctctagaagactcgggcacctatgcgtgcagagccagg
aacatatacacaggggaagacatccttcggaagacagaagttctcgttagagattcggaa
gcgccacacctgcttcaaaacctcagtgactacgaggtctccatcagtggctctacgacc
ttagactgtcaagctagaggtgtccccgcgcctcagatcacttggttcaaaaacaaccac
aaaatacaacaagaaccgggaattattttaggaccaggaaacagcacgctgtttattgaa
agagtcacagaggaggatgagggtgtctataggtgccgagccaccaaccagaagggggcc
gtggaaagcgcagcctacctcaccgtgcaaggaacctcagacaagtcaaacctggagctg
atcacgctcacgtgcacatgcgtggctgcgaccctcttttggctccttctaactctcttc
atcagaaaactgaagcggtcttcttccgaagtaaagacagactacctgtcaatcattatg
gacccagatgaagttcccctggatgagcagtgtgaacggctgccctatgatgccagcaag
tgggagtttgcacgggagagactgaaactaggcaaatcgctcggaagaggggcttttggg
aaagtcgttcaagcctctgcatttggcattaagaaatcacccacctgccggactgtggct
gtgaagatgttgaaagagggggccacagccagtgagtacaaagctctgatgaccgaactc
aagatcttgacccacatcggccatcatctgaatgtggttaacctcctgggagcctgcacg
aagcaaggagggcctctgatggtgatcgtggaatactgcaaatacggaaacctgtccaac
tacctcaagagcaaacgtgacttattctgtctcaacaaggacgcagccttgcatatggag
ctcaagaaagagagcctggaaccaggcctggagcagggccagaagccccgcctagacagt
gtcagcagctcaagtgtcaccagctccagcttccctgaagaccgaagcgtgagcgatgtg
gaaggagacgaggattacagtgagatctccaagcagcccctcaccatggaagacctgatt
tcctacagtttccaagtggccagaggcatggagtttctgtcctccagaaagtgcattcat
cgggacctggcagcgagaaacatccttttatctgagaacaatgtggtgaagatttgcgac
tttggcctggcccgggatatttataagaaccctgattatgtgaggagaggagatactcga
cttcccctaaaatggatggctcctgaatccatctttgacaaggtctacagcaccaagagc
gatgtgtggtcctatggcgtgttgctgtgggagatcttctccttagggggttctccatac
ccaggagtgcaaatggatgaagacttctgcagccgcctgaaggaaggcatgcggatgaga
accccggagtatgccacacctgaaatctaccaaatcatgttggattgctggcacaaagac
cccaaagagaggccccggtttgctgaacttgtggagaaacttggtgacctgcttcaagcc
aacgtccaacaggatgggaaagattacatccccctcaatgccatactgactagaaacagt
ggcttcacatactcgacccccaccttctctgaggaccttttcaaggacggctttgcagat
ccacattttcattccggaagctctgatgatgtgagatatgtaaacgctttcaaattcatg
agcctggaaagaatcaaaacctttgaggagctttcaccgaactccacctccatgtttgag
gactatcagctggacactagcactctgctgggctcccccttgctgaagcggttcacctgg
actgagaccaagcccaaggcctccatgaagatagacttgagaatagcgagtaaaagcaag
gaggcgggactttccgatctgccgaggcccagcttctgcttctccagctgtggccacatc
aggcccgtgcaggacgatgaatctgagctgggaaaggagtcctgctgttctccaccccca
gactacaactccgtggtgttgtactcctccccgcccgcctaa

DBGET integrated database retrieval system