KEGG   Mus musculus (mouse): 14256Help
Entry
14256             CDS       T01002                                 

Gene name
Flt3l, Flt3lg, Ly72L
Definition
(RefSeq) FMS-like tyrosine kinase 3 ligand
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14256 (Flt3l)
   04010 MAPK signaling pathway
    14256 (Flt3l)
   04151 PI3K-Akt signaling pathway
    14256 (Flt3l)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14256 (Flt3l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14256 (Flt3l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14256 (Flt3l)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14256 (Flt3l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flt3_lig
Motif
Other DBs
NCBI-GeneID: 14256
NCBI-ProteinID: NP_038548
MGI: 95560
Ensembl: ENSMUSG00000110206
Vega: OTTMUSG00000033411
UniProt: P49772 A9QW46
LinkDB All DBs
Position
7 B3; 7 29.14 cM
AA seq 232 aa AA seqDB search
MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVT
VAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPEC
LRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEAT
ELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctggcgccagcctggagcccaaattcctccctgttgctgctgttgctgctg
ctgagtccttgcctgcgggggacacctgactgttacttcagccacagtcccatctcctcc
aacttcaaagtgaagtttagagagttgactgaccacctgcttaaagattacccagtcact
gtggccgtcaatcttcaggacgagaagcactgcaaggccttgtggagcctcttcctagcc
cagcgctggatagagcaactgaagactgtggcagggtctaagatgcaaacgcttctggag
gacgtcaacaccgagatacattttgtcacctcatgtaccttccagcccctaccagaatgt
ctgcgattcgtccagaccaacatctcccacctcctgaaggacacctgcacacagctgctt
gctctgaagccctgtatcgggaaggcctgccagaatttctctcggtgcctggaggtgcag
tgccagccggactcctccaccctgctgcccccaaggagtcccatagccctagaagccacg
gagctcccagagcctcggcccaggcagctgttgctcctgctgctgctgctgctgcctctc
acactggtgctgctggcagccgcctggggccttcgctggcaaagggcaagaaggaggggg
gagctccaccctggggtgcccctcccctcccatccctag

DBGET integrated database retrieval system