KEGG   Mus musculus (mouse): 14281Help
Entry
14281             CDS       T01002                                 

Gene name
Fos, D12Rfj1, c-fos, cFos
Definition
(RefSeq) FBJ osteosarcoma oncogene
  KO
K04379  proto-oncogene protein c-fos
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04024  cAMP signaling pathway
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04713  Circadian entrainment
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05031  Amphetamine addiction
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05224  Breast cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14281 (Fos)
   04668 TNF signaling pathway
    14281 (Fos)
   04024 cAMP signaling pathway
    14281 (Fos)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14281 (Fos)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    14281 (Fos)
   04660 T cell receptor signaling pathway
    14281 (Fos)
   04658 Th1 and Th2 cell differentiation
    14281 (Fos)
   04659 Th17 cell differentiation
    14281 (Fos)
   04657 IL-17 signaling pathway
    14281 (Fos)
   04662 B cell receptor signaling pathway
    14281 (Fos)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    14281 (Fos)
   04917 Prolactin signaling pathway
    14281 (Fos)
   04921 Oxytocin signaling pathway
    14281 (Fos)
   04926 Relaxin signaling pathway
    14281 (Fos)
   04928 Parathyroid hormone synthesis, secretion and action
    14281 (Fos)
  09156 Nervous system
   04725 Cholinergic synapse
    14281 (Fos)
   04728 Dopaminergic synapse
    14281 (Fos)
  09158 Development
   04380 Osteoclast differentiation
    14281 (Fos)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14281 (Fos)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14281 (Fos)
   05231 Choline metabolism in cancer
    14281 (Fos)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    14281 (Fos)
  09162 Cancer: specific types
   05210 Colorectal cancer
    14281 (Fos)
   05224 Breast cancer
    14281 (Fos)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14281 (Fos)
  09165 Substance dependence
   05031 Amphetamine addiction
    14281 (Fos)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14281 (Fos)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    14281 (Fos)
   05135 Yersinia infection
    14281 (Fos)
   05133 Pertussis
    14281 (Fos)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14281 (Fos)
   05170 Human immunodeficiency virus 1 infection
    14281 (Fos)
   05162 Measles
    14281 (Fos)
   05161 Hepatitis B
    14281 (Fos)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14281 (Fos)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14281 (Fos)
   05142 Chagas disease (American trypanosomiasis)
    14281 (Fos)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    14281 (Fos)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14281 (Fos)
   04131 Membrane trafficking [BR:mmu04131]
    14281 (Fos)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14281 (Fos)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    14281 (Fos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 14281
NCBI-ProteinID: NP_034364
MGI: 95574
Ensembl: ENSMUSG00000021250
Vega: OTTMUSG00000019764
UniProt: P01101
LinkDB All DBs
Structure
PDB: 

Position
12 D2; 12 39.7 cM
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT
LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYA
ADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc
tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg
ggctctcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt
atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact
ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc
cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcaggaggcagagcg
cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg
agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag
ctgacagatacactccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag
actgagattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac
cgacctgcctgcaagatccccgatgaccttggcttcccagaggagatgtctgtggcctcc
ctggatttgactggaggtctgcctgaggcttccaccccagagtctgaggaggccttcacc
ctgccccttctcaacgaccctgagcccaagccatccttggagccagtcaagagcatcagc
aacgtggagctgaaggcagaaccctttgatgacttcttgtttccggcatcatctaggccc
agtggctcagagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca
gcagactgggagcctctgcacagcaattccttggggatggggcccatggtcacagagctg
gagcccctgtgtactcccgtggtcacctgtactccgggctgcactacttacacgtcttcc
tttgtcttcacctaccctgaagctgactccttcccaagctgtgccgctgcccaccgaaag
ggcagcagcagcaacgagccctcctccgactccctgagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system