KEGG   Mus musculus (mouse): 14296Help
Entry
14296             CDS       T01002                                 

Gene name
Frat1, AW060382
Definition
(RefSeq) frequently rearranged in advanced T cell lymphomas
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14296 (Frat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14296 (Frat1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14296 (Frat1)
   05226 Gastric cancer
    14296 (Frat1)
   05224 Breast cancer
    14296 (Frat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSK-3_bind
Motif
Other DBs
NCBI-GeneID: 14296
NCBI-ProteinID: NP_032069
MGI: 109450
Ensembl: ENSMUSG00000067199
Vega: OTTMUSG00000060253
UniProt: P70339 B2RU64
LinkDB All DBs
Position
19 C3; 19 35.3 cM
AA seq 274 aa AA seqDB search
MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDQLIVQIGETLQLDAAHDRPA
SPCAAPGPPPPQVLAALPADKTGTPARRLLRPTGSAETGNPAPPGAVRCVLGERGRVRGR
SAPYCVAEISPGASALPQQPGLDGPPGTGKLSTPQPLSGPCRRGWLRNAAASRRLQQRRG
SQPETRTGDDDDPHRLLQQLVLSGNLIKEAVRRLHSRQLQLHAKLPAHPFLGPLSAPVHE
PPSPGSPRAACSDPGAFMGRAQLRTGDDLLVPGS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccttgccggagggaggaggaggaggaagccggcgacgaggcggagggggaggaggac
gacgacagcttcctcctgctgcagcagtcggtgactctgggtggctcgaccgacgtggac
cagctcatcgtccagatcggcgagacgctgcagctggacgcagcgcacgatcgcccggcc
tcgccgtgtgccgccccgggtcccccgcccccgcaggtcctggcggcgctgccggcggac
aagaccgggaccccagctaggaggctgctgcggccgacggggtcagcggagaccgggaac
cctgcgcccccgggggccgtgcgctgcgtgctaggggagcgcgggcgcgtgcggggacgg
tcggcgccctactgcgtggcggagatctcccccggcgccagcgcgctgccccagcagccg
ggccttgacggacccccggggaccggcaaactaagcaccccgcagccactgtcgggcccg
tgccgccggggttggctccggaacgcagccgcgtcccgccgcttgcaacagcgacgcgga
tctcagccggagacccgcactggcgacgacgacgacccgcaccggctcctgcagcagctc
gtgctctcgggaaacctcatcaaggaggcggtgcgcagacttcattcgcgacagctacag
ttacacgcaaagcttcccgcacacccgttcctcgggcctctgtcagccccagtgcatgag
ccgccttcgcccgggagccctcgcgcggcctgcagcgaccctggcgctttcatggggagg
gcgcagctcagaactggggacgaccttcttgtccctggcagctaa

KEGG   Mus musculus (mouse): 212398Help
Entry
212398            CDS       T01002                                 

Gene name
Frat2
Definition
(RefSeq) frequently rearranged in advanced T cell lymphomas 2
  KO
K03096  frequently rearranged in advanced T-cell lymphomas 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    212398 (Frat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    212398 (Frat2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    212398 (Frat2)
   05226 Gastric cancer
    212398 (Frat2)
   05224 Breast cancer
    212398 (Frat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSK-3_bind PRIMA1
Motif
Other DBs
NCBI-GeneID: 212398
NCBI-ProteinID: NP_808271
MGI: 2673967
Ensembl: ENSMUSG00000047604
Vega: OTTMUSG00000060254
UniProt: Q8K025
LinkDB All DBs
Position
19 C3; 19 35.33 cM
AA seq 231 aa AA seqDB search
MPCRREEEEEAGDEAEGEEDDDSFLLLQQSVTLGGSTDVDRLIVQIGETLQLDTAHDRPA
SPCAAPGPPPAPPRVLAALSADKTGTPARRLLRPTGSAETGDPAPPGAVRCVLGERGRVR
GRSAPYCVAEIAPGASALPGPGRRGWLPGSVASHRIQQRRWTAGGARAADDDPHRLLQQL
VLSGNLIKEAVRRLQRAVAAVAATSPASAPGSGGGRSGPDSVTLQPSGAWL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgccttgccggagagaggaggaggaggaagccggcgacgaggcagagggggaggaggac
gacgacagcttcctcctgctgcagcagtcggtgactctgggcggctcgaccgacgtggat
cggctcatcgtccagatcggcgagacgctgcagctggacacggcgcacgatcgcccggcc
tcgccgtgtgccgccccgggtcccccacccgcgcctccgcgggtcctggcggcgctgtcg
gcggacaagaccgggaccccagcgaggcggctgctgcggccgacggggtcagcagagacc
ggggaccctgcgcctccgggggccgtgcgctgcgtgctgggggagcgcgggcgtgtgcgg
ggccgatcggcgccctactgcgttgcggagatcgccccgggtgccagcgcgcttcccggg
ccggggcggcgagggtggctccccggctccgtggcttctcaccgaatccagcagcggcgg
tggacagcaggcggagcgcgcgcggccgacgacgacccgcaccggctcctgcagcagctc
gtgctctccggaaacctcatcaaggaggcggtgcgcagactccagcgagcggtcgccgcg
gttgcggccacgagccccgcgagcgctccggggtccgggggtggccgaagcggaccggac
tcagtcactctgcagccctcgggcgcctggctctga

KEGG   Mus musculus (mouse): 27412Help
Entry
27412             CDS       T01002                                 

Gene name
Peg12, Frat3
Definition
(RefSeq) paternally expressed 12
  KO
K03069  frequently rearranged in advanced T-cell lymphomas 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    27412 (Peg12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27412 (Peg12)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    27412 (Peg12)
   05226 Gastric cancer
    27412 (Peg12)
   05224 Breast cancer
    27412 (Peg12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSK-3_bind
Motif
Other DBs
NCBI-GeneID: 27412
NCBI-ProteinID: NP_038816
MGI: 1351637
Ensembl: ENSMUSG00000070526
Vega: OTTMUSG00000059567
UniProt: Q9WVA7
LinkDB All DBs
Position
7 C; 7 34.38 cM
AA seq 283 aa AA seqDB search
MPCRREEEAGDEAEGEEDDNSFLLLQQSVTLGGSADVDRLIAQIGETLQLDARHDGPASP
CAAPGPPPAPPRVLAALPADKAGAPARRLLRRAASAEAGDPAPPGAVRCVLGERGRLRGR
AAPYCVAEIAPGASALPQQLGLEVSPGMGKVSIPQPLSGRCRRGWLRNAAASRRQQQRRG
SQSETRTSDGDPPRLLQQLLLSGNLIKEAVRRLHSRGLQLQAKLPAHSFLGPLSAPVHEP
PLPGSPRAACSDPGDCDGGHSSELGTTFLSLAANNPGGHSTNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaagaggaagccggcgacgaggcggagggggaggaggacgacaac
agcttcctcctgctgcagcagtccgtgactctggggggctctgccgacgtggaccggctc
atcgcccagatcggcgagacgctgcagctggacgccaggcacgatggcccggcctcgcca
tgtgctgccccgggccccccgcccgcgcccccgcgggtcctggccgcgctgccggcggac
aaggccggggccccagcgaggcggctgctacggagagcagcatcagcggaggccggggac
cctgcgcccccgggggctgtgcgctgcgtgctgggggagcgcgggcgcctgcggggccgg
gcggcgccctactgtgtggcggagatcgccccgggcgccagcgcgctgccccagcagctc
ggccttgaggtatccccggggatgggcaaagtaagcatcccgcagccactgtccggccgg
tgccggcggggttggctccggaacgcagccgcgtcccgccgccagcaacagcgacgcgga
tctcagtcggagacccgcacgagtgacggcgacccgccccgactcctgcagcagctcctt
ctttcgggaaacctcatcaaggaggcggtgcggagacttcattcgcgagggctacagcta
caggcaaagcttcccgctcactcgttcctcgggcctttgtcagccccggtgcatgagccg
cctttgcccgggagcccccgtgcagcctgcagcgaccctggcgattgtgatggagggcac
agctcagaactagggacgaccttcttgtccctggcagctaataaccccggtggccacagc
accaacctgtag

DBGET integrated database retrieval system