KEGG   Mus musculus (mouse): 14357Help
Entry
14357             CDS       T01002                                 

Gene name
Dtx1, Fxit1, mKIAA4160
Definition
(RefSeq) deltex 1, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    14357 (Dtx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    14357 (Dtx1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     14357 (Dtx1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    14357 (Dtx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-ANAPC11 zf-UDP
Motif
Other DBs
NCBI-GeneID: 14357
NCBI-ProteinID: NP_032078
MGI: 1352744
Ensembl: ENSMUSG00000029603
Vega: OTTMUSG00000025278
UniProt: Q61010
LinkDB All DBs
Position
5 F; 5 60.64 cM
AA seq 627 aa AA seqDB search
MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPP
PPLPPGGPPGALVVRPSATFAGAALWAAPATGPTEPAPPPGVPPRSPSAPNGAPTPGQNN
LSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRA
PKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTI
CMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKA
IYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFP
RHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGH
GYPDASYLDNVLAELTAQGVSEAMAKA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggccaggccaaggtgtgatggtgccggtgaacgggctgggcttcccgccgcag
aacgtggccagggtggtggtgtgggagtggctcaatgagcacagccgctggcgaccctac
acggccaccgtgtgccaccacatcgagaatgttcttaaggaggatgcccggggctctgtg
gtccttggccaggtggacgcccagctggtgccctacatcatcgacctacaatccatgcat
cagttccggcaagacacaggtaccatgcggccggtgcgacgcaacttctacgatccatcg
tcggcgccgggcaagggcatcgtgtgggaatgggagaacgacggcggggcgtggacggcc
tacgacatggacatctgcatcaccatccagaacgcgtacgagaagcagcacccgtggctc
gacctctcatcgctcggcttctgctacctcatctacttcaacagcatgtcccagatgaac
cgccagacgcgccgccgccgccgcctgcgccgtcgcctggacctggcttacccgctcact
gtcggctccattcccaagtcgcaatcctggcccgtgggagccagctcgggtcagccctgc
tcctgtcagcagtgcctgctggtcaacagcacgcgcgccgcctccaacgccatcctggcc
tcgcagcgccgcaaggctcccattgcgccagccgcgcctccagcgccccctccgcccccg
ccgccgctgccacccggaggacctccgggtgcgctcgttgtgcgccccagcgccactttc
gccggagctgcgctctgggccgcacctgccaccggccccacggagcctgcgccgcctcca
ggagttcccccaaggagccctagtgcccccaacggagcgcccacaccgggccaaaacaac
ctcagtcgaccaggaccacagaggtccaccagcgtcagcgcacgcgcctctatcccgcct
ggggttccggcgctccccgtgaagaacttgaatggcactggccctgtccacccagccttg
gcagggatgaccgggatcctgctgtgtgcagcggggctgccggtgtgcctgacacgagca
cccaaacccatcctgcacccaccaccagtaagcaaaagcgacgtgaagcctgtgcctgga
gtgcccggcgtgtgccgcaagaccaagaagaaacacctcaagaaaagcaagaatcctgag
gatgtggttcggaggtacatgcagaaggtgaaaaacccgcctgatgaggactgtaccatt
tgcatggagcggctggtcacagcatctggctatgagggcgtgctccgaaacaagagtgtg
cggcccgagcttgtgggccgcctgggccgctgcggccacatgtatcacctgctctgcctg
gtggccatgtactccaatggcaacaaggatggcagcctgcagtgtccaacctgcaaagcc
atctacggggagaagacagggacacagccaccagggaagatggagtttcacctcatcccg
cactcgctgcctggttttgcagacacccagacgatccgcatcgtctatgacatccccacg
ggcatccagggccctgaacatcccaacccaggcaagaagttcacagccagaggcttccct
cgccactgctacctacccaacaatgagaagggccgaaaggtgctgagattgctcatcacc
gcctgggaacgcagactcatcttcactatcggaacatccaacaccacgggcgagtcggac
accgtggtgtggaacgagattcaccacaagacggagtttggttccaacctcactggtcac
ggctaccccgacgccagctacctagacaacgtgctggctgagctcaccgcccagggggtt
tctgaggccatggccaaggcctga

KEGG   Mus musculus (mouse): 207521Help
Entry
207521            CDS       T01002                                 

Gene name
Dtx4, AI449438, BC044798, D930042H13, RNF155
Definition
(RefSeq) deltex 4, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    207521 (Dtx4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    207521 (Dtx4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     207521 (Dtx4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    207521 (Dtx4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-rbx1 zf-RING_5 zf-RING_11 zf-ANAPC11 PHD Zn_ribbon_17 zf-UDP
Motif
Other DBs
NCBI-GeneID: 207521
NCBI-ProteinID: NP_766030
MGI: 2672905
Ensembl: ENSMUSG00000039982
UniProt: Q6PDK8
LinkDB All DBs
Position
19; 19 A
AA seq 616 aa AA seqDB search
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDL
QSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQYAYEKQ
HPWIDLTSIGFSYIIDFSTMGQINRQTQRQRRVRRRLDLIYPMVTGTMPKTQSWPVSPGP
ATSSPAPPCSCPQCVLVMSVKAAVVHGGTGPPAVRKNMALSGVGKLPQPPGPGAKPLDTT
GTIRGPGKTAPSQVIRRQVSNAPAGATVGSPASPQGSNRKTGRVALATLNRSNLQRLAIA
QSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSK
SEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYK
GPQPTVKPDLVGKLSRCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKM
EYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKV
LKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAE
LAAQGISEDSTSHEKD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggcctcggcagtggtggtgtgggaatggctgaacgaacacggccgctggcgt
ccctacagcccagccgtgagtcaccacatcgaggcggtggtgcgcgctggtccccgcgcc
gggggcagcgtggtgttgggccaggtggacagccggctcgcgccctacatcatcgacctg
cagtccatgaaccagttccgccaagacacggggaccctccgcccagttcgacgaaactac
tatgacccatcctcagcccctggtaagggagtcgtgtgggaatgggagaatgacaatggt
tcctggactccctatgacatggaagtcggcatcaccatccagtatgcctatgagaagcag
cacccatggatcgacctcacctccattggcttcagctacataatagacttcagcaccatg
ggccagatcaacaggcagacccaacgccagcgccgtgtcagacgacgactagacctcatc
taccccatggtcacgggcactatgccaaagactcagtcctggccagtcagtcctggaccg
gcgacgtcctcccctgcaccaccttgctcctgtccacagtgtgttttggtgatgagcgtc
aaggctgctgtggtccatgggggcactgggcctccagcagtacgaaagaacatggccctc
tctggagtgggcaagctgccccagccacctggccctggagcaaagccactagacaccact
ggcaccattcgaggcccagggaagacagccccatcgcaggttatcagaagacaagtctct
aatgcaccagctggggcgactgtaggctcccctgccagcccacaaggaagcaacaggaag
actggaagggtggcactggccactttgaatcggtccaatctgcagcgactggccattgcc
cagtcccgggtgctgattgcctccggggttcccactgtgcctgtgaaaaacttgaatggg
tccagccctgttaatcctgccttggcaggaatcaccgggatactcatgagtgcagcggga
ttgcctgtgtgcctcactcgcccaccaaagctggtcctccacccgccccctgtcagcaag
agtgagataaagtccatcccaggggtctcgaacacgagccgcaagaccaccaaaaagcaa
gccaagaaaggtaaaaccccagaggaagtgctaaagaagtacctgcagaaggtccggcac
ccaccagaagaggattgtaccatctgtatggagcgtctcacagccccctctggctacaaa
ggcccacagcctacagtcaagcctgacctggtgggaaagctgtccaggtgtggccacatc
taccacatctactgcctggtggctatgtacaacaatgggaacaaggatgggagtttacag
tgcccaacatgtaagaccatttatggcgtcaagacaggcacccagcctccagggaagatg
gaataccacctcatcccccactccttgcctggccatccggactgcaagaccatccggatc
atctacagtatcccccctggcattcagggaccagagcatccgaatcctgggaagagcttc
agtgcccgtggcttcccacgacattgttaccttccagacagcgagaaggggagaaaagtt
ctgaagctgcttctagtggcctgggaccgccgtctcatctttgccattggaacctccagc
accacgggcgagtccgatactgtcatctggaatgaggttcaccacaaaacagaatttggc
tctaatctcactggccatggctacccagatgccaattacctggataacgtgctggctgaa
ctggctgcccagggtatctctgaagacagcacttcccatgaaaaggactga

KEGG   Mus musculus (mouse): 209200Help
Entry
209200            CDS       T01002                                 

Gene name
Dtx3l, AU042200, BC023741
Definition
(RefSeq) deltex 3-like, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    209200 (Dtx3l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    209200 (Dtx3l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     209200 (Dtx3l)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    209200 (Dtx3l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-C3HC4 zf-RING_6 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-RING_4 Baculo_IE-1 Prok-RING_4
Motif
Other DBs
NCBI-GeneID: 209200
NCBI-ProteinID: NP_001013389
MGI: 2656973
Ensembl: ENSMUSG00000049502
Vega: OTTMUSG00000023635
UniProt: Q3UIR3
LinkDB All DBs
Position
16; 16 B3
AA seq 748 aa AA seqDB search
MASSPDPPSPLLVRLRESIPKAHRKLEIYFQSRASGGGECSVQPVGPSAPDTYEVKFLKK
ADKEKVLKKSEHEMLVHNKPVTIVLETTKKPVEDLRPRLPSLTQPVETPSSRPPSLTGSL
DEALCDDIHPQDGLVSNSVDSVVQKIFLAVTAELNCDLLSKEQRASITTVCPHIIKSMEG
SDGIKKVCGNFKDIEKIHHFLSEQLLEREQKRKGSEQKRKCAPQKHTPPDVEREPPDQSS
IQVPVLLLEYFKHVNPGRLEFIEYKFGVNIEIQASSPNMVTVGFTSSPFGNVEEASQSFV
RDFQKCSQSLKQDCISLEEHQRAKEVRQELSRCFPKLLIKGQGRTLTLLGSPADISAATE
KVSQGLGLRPVKITASGYTTGIEVDSTRFKLLEPELLQEISEIEQKFNTRGKVQEKGQKT
CILFVPKDKDLDLSVQSYTGFTDAFQRATWQLRTEVLSLKGLGKERARLHNTKFADNFKK
EHPNVHFVTSQESVTLTGLPHHLAQAMQYVSKRMGLAPSSGEKLAMDQETPMEISSSDPH
GDQQENAALPAPRGTSSSPAASKGTEDYCVICMDTISNKHVLPKCKHEFCTSCISKAMLI
KPVCPVCLTSYGIQKGNQPEGTMSYSTQKGSLPGYEGCGTIVINYEIKDGIQTKEHPNPG
KAYHGTRRTAYLPDNTEGRKVLDLLHEAFKHRLTFTIGYSRATGVSDVITWNDIHHKTSK
FGGPANFGYPDPDYLKRVKEELKAKGIE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagtcccgacccgccgtccccgctactcgtacggctgcgggagtccatcccc
aaggcgcacaggaagctcgagatatacttccagagccgggcctcgggaggtggggagtgc
tctgtccagcccgtgggccccagcgccccggacacctacgaggtgaagttcctaaaaaaa
gcagataaggagaaagtgttgaaaaagagcgaacacgagatgttggtccataacaaacct
gtgaccattgtcctggaaactactaaaaagccagtagaggacctgagacccagactccca
tccttgacacagccagtggagacaccaagctccagacctccgtccttgacggggtctctg
gatgaagcactttgtgatgacatacatccccaggacgggctcgtttctaactctgttgac
tcagttgtccaaaagatctttcttgctgtgaccgctgagctgaactgtgacctgctctct
aaagagcagagagcatctataaccactgtctgccctcacatcatcaaaagcatggagggt
agtgatggaattaagaaggtgtgtggcaacttcaaagatattgaaaagatacatcacttc
ttgagtgagcagcttttggaacgggagcagaaacggaagggaagcgagcagaaacggaag
tgcgccccacagaaacacacacctcccgatgtggagcgggagccccctgatcagagcagt
attcaagttcctgtgcttctccttgaatatttcaagcatgttaatccgggtagactagag
ttcatagagtacaaatttggtgtaaacattgaaatccaagctagttctcccaatatggtc
actgtaggcttcacctccagcccatttggcaacgtagaagaagcaagtcagtcctttgtc
agagactttcagaaatgctcgcagtctctgaagcaagattgtatctctttagaggagcac
cagagagcaaaggaggtcagacaggagctgagtcgctgcttcccaaagctcttgataaag
ggacagggaagaacgctgactctcctcggctctcctgctgacatttcagccgccacagaa
aaagtctcccaaggtcttggcctgagacctgtgaaaataaccgcatctgggtacacgacg
ggcatcgaggtcgattcaacacgctttaagcttctagagcctgaactgctccaggaaatc
tcagagatcgagcagaagtttaacacccgtggcaaagtccaggaaaaaggccagaaaacc
tgcattctttttgtccccaaggataaagacttagacctgtcagtgcagtcctacacaggt
tttactgatgccttccagcgtgccacgtggcagctgaggacagaagttctgtcgctgaaa
gggttgggcaaggagagagctcgcttacacaataccaagtttgccgacaactttaaaaaa
gagcacccgaatgtgcactttgtgacatctcaggagtcagtgaccttgactggcttgcca
catcaccttgcgcaggcaatgcagtatgtctccaaaagaatgggactggcaccgtcatct
ggagagaaactcgctatggatcaggaaacccccatggagatcagcagtagtgacccccat
ggagatcagcaggagaatgcagccttacctgctccccgaggcacctctagcagccctgca
gcttcgaaggggactgaggactactgtgtcatctgcatggataccatcagcaacaagcac
gtgctccccaagtgcaagcatgaattctgcacctcgtgtatcagcaaagccatgcttatc
aagcctgtctgtcctgtgtgtctgacttcctacggcatccagaaagggaaccagccagag
ggaaccatgtcttactccactcaaaaagggtcacttccaggttatgaaggctgtggcacc
attgtgattaattatgaaataaaagatggcatccaaacaaaagagcacccaaacccagga
aaggcttatcatggaacacggcgaactgcatacttgcctgataatactgagggaagaaag
gttttggatctgctccacgaagcctttaagcacagactgactttcacaataggatactct
cgagcaacaggagtctcggatgtcattacatggaatgatattcatcacaaaacatccaag
tttggaggaccagcaaattttggctaccctgatcctgattacctgaaacgtgtcaaggag
gagctgaaagcaaaaggcattgagtaa

KEGG   Mus musculus (mouse): 74198Help
Entry
74198             CDS       T01002                                 

Gene name
Dtx2, 2610524D08Rik, AA408415, AU022494, Deltex2
Definition
(RefSeq) deltex 2, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    74198 (Dtx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    74198 (Dtx2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     74198 (Dtx2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    74198 (Dtx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_UBOX zf-RING_11 zf-RING_2 zf-ANAPC11 zf-RING_5 zf-UDP
Motif
Other DBs
NCBI-GeneID: 74198
NCBI-ProteinID: NP_001243025
MGI: 1921448
Ensembl: ENSMUSG00000004947
Vega: OTTMUSG00000025375
UniProt: Q8R3P2
LinkDB All DBs
Structure
PDB: 

Position
5; 5 G2
AA seq 619 aa AA seqDB search
MAMAPSSSLPQVYPSHVVVAVWEWQDGLGIWHPYSATVCSFIEQHFVRQRGQHFGLGSLA
HSIPLGQADPSLAPYIIDLPSWTQFRQNTGTMRSVRRHLFSQNSAPGQGIVWEWLGDDGS
WVAYEARICDYLEQQVARGIQVVDLAPLGYNYTVNYATLTQTNKTSSFCRSVRRQVGPVY
PVTSDIAVPRQMGLICFCQQCLHGSGTGPVSGRYRHSMTNLPAYPAPQAPHRTTTVSGAH
QAFAPYNKPSLSGARSAPRLNTTNPWAAAPPVAGNQSLFHSSLSHLGPQLLPSGPSTSSG
ASASFPSGPSSSSPGSAPTTVPVQMPKASRVQQALAGMTSVLSAIGLPVCLSRAPRPTGP
PASRPASKSHSSVKRLRKMSVKEGAPKPEPEQVIRKYTEELKVAPEEDCIICMEKLAVAS
GYSDMTDSKALGPMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKTGTQ
PWGKMEVFRFQMSLPGHEDCGTILIVYNIPHGIQGPEHPSPGKPFTARGFPRQCYLPDSP
QGRKVLELLKVAWKRRLIFTVGTSSTTGETDTVVWNEIHHKTEMDRNVTGHGYPDPNYLQ
NVLAELAAQGVTEDCLEQQ
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccccaagctcgtctctgccgcaggtgtaccctagccacgtggtggtggct
gtgtgggaatggcaggatgggcttggcatttggcacccctacagtgccactgtctgctcc
ttcattgagcagcattttgtccggcagaggggccagcattttggactgggaagcctggcc
cacagcatccccttaggccaagctgacccctcactggccccttacatcatcgacctcccc
agctggactcagtttcgccagaacactggcaccatgaggtctgtgcgcagacacctgttc
tcacagaattctgccccaggccagggcatcgtctgggagtggctgggcgatgacggatcc
tgggtagcctatgaagctagaatctgtgactatctggaacagcaagtggcccggggcatc
caggtcgtggacttggcaccactggggtataactatactgtcaactatgccaccctaacc
caaaccaacaagacttccagcttctgccggagtgtgcgacgccaagtggggccagtttac
ccagtgacttcagacatcgctgttccacgccaaatgggacttatctgcttttgccaacag
tgcctccatggtagcggaactggccctgtgtcgggccgctaccgccactccatgaccaac
ctgcctgcatatcctgccccccaagcaccccaccggaccaccactgtctctggggcccac
caggcctttgccccatacaataaaccttcactgtctggggccagatctgcaccaaggttg
aacaccaccaacccctgggctgcagcacctcctgttgcaggcaaccagtccctgttccac
tccagcctctcccacctggggcctcagctcctgccctcaggaccgtccacctccagtgga
gccagtgcctccttccccagcgggccctcctccagcagcccagggagcgcccccaccact
gtgcccgtgcagatgccaaaggccagcagggtccagcaggcgcttgcaggcatgacgagt
gtgctgtcagccattggactccctgtgtgtcttagccgtgcaccccggcccaccggccct
cccgcctcccgtccggcctctaaaagtcacagctcagttaagaggctgaggaaaatgtcc
gtaaaagaaggggcgcctaagcccgagccggagcaggtgatcagaaagtacaccgaggag
ctgaaagtggcccctgaagaggactgcattatctgtatggagaaactggctgtggcttct
gggtacagtgacatgactgacagcaaggccctcgggcccatggtcgtgggccgcctcacc
aagtgcagccatgccttccacctgctgtgcctgctggccatgtattgcaacgggaacaag
gacgggagtcttcagtgtccgtcgtgcaaaaccatctatggggagaagactgggacgcag
ccctgggggaagatggaggtgttcaggttccaaatgtccctcccaggccatgaagactgt
gggactatactcattgtttacaacatccctcatggcatccagggaccagagcaccccagc
cctgggaagccattcactgcccggggctttccccggcaatgctacctgccagatagccct
cagggccgcaaggtcctggagctcctgaaggtggcctggaagaggcgactcatttttacc
gtgggcacttccagcaccacaggtgagaccgacaccgtggtgtggaacgagatccaccac
aagaccgagatggaccgcaacgtgacaggccacggctatccggaccccaactacctgcag
aatgtgctggctgagctcgctgcccagggagtgaccgaagactgcctggaacagcagtga

KEGG   Mus musculus (mouse): 80904Help
Entry
80904             CDS       T01002                                 

Gene name
Dtx3, Deltex3, mg310
Definition
(RefSeq) deltex 3, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    80904 (Dtx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    80904 (Dtx3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     80904 (Dtx3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    80904 (Dtx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DTC zf-C3HC4_2 zf-RING_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-rbx1 zf-RING_5 zf-Nse Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-ANAPC11 DUF1644 zf-RING_11 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 80904
NCBI-ProteinID: NP_109639
MGI: 2135752
Ensembl: ENSMUSG00000040415
Vega: OTTMUSG00000033472
UniProt: Q80V91
LinkDB All DBs
Position
10; 10 D3
AA seq 347 aa AA seqDB search
MSFVLSRMAACGGSCKNKVTVSKPVWDFLSKETPARLARLREEHRVSILIDGETSDIYVL
QLSPQGPPPAPPNGLYLARKALKGLLKEAEKELKKAQRQGELMGCLALGGGGEHPELHRP
GPPPLRAAPLLPPGARGLPPPPPPLPPPLPPRLREDAEEQETTCPICLGEIQNAKTLEKC
RHSFCEGCITRALQVKKACPMCGRFYGQLVGNQPQNGRMLVSKDATLLLPSYEKYGTIVI
QYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTLFRKAFDQRLTFTIGTSMTT
GRPNVITWNDIHHKTSCTGGPQLFGYPDPTYLTRVQEELRAKGITDD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgtcctgtccagaatggcagcctgtggaggctcctgcaagaacaaagtgact
gtctccaagcctgtgtgggacttcctgagcaaggagaccccagcccggctggcccggctt
cgggaggagcatcgggtgtccatcctcatagatggcgagacttctgacatctacgtgctc
cagctgtccccacagggtcctcccccagcccctcccaatgggctctacctggccaggaag
gctctcaaggggctactgaaagaggcagagaaagagctaaagaaagcccagaggcagggg
gagctcatgggctgcctggctttggggggtggaggggaacaccccgagctgcaccgccca
ggccctcctcccctccgagcagccccactcctgcccccaggggcaagagggctaccccct
cctcctcctcccctgccccctccactccctcctcgtctcagagaggacgctgaagagcag
gaaaccacctgccccatttgcctgggggagatacagaatgccaagacgctggagaagtgc
aggcactccttctgtgagggctgcatcacacgggccctgcaggtgaaaaaggcctgcccc
atgtgcggccgattctacgggcagcttgtgggcaaccagccccagaacggacggatgctg
gtctccaaggatgccaccctcctgctgcccagctacgagaagtatggcaccattgtcatc
caatatgtcttcccgcctggcgtccagggggctgaacaccccaacccaggagttcggtac
cctggtaccacacgggtggcctacctcccggactgccccgagggcaacaaggtgctgacc
ctgttccgaaaggcatttgaccagcgcctcaccttcaccatcggcacgtccatgactaca
gggagacccaatgtcatcacttggaacgacatccaccacaagaccagctgcacaggggga
ccccagctgtttgggtatccggacccaacctacctgactagggtgcaagaggaactgaga
gccaagggtatcacagacgactga

DBGET integrated database retrieval system