KEGG   Mus musculus (mouse): 14360Help
Entry
14360             CDS       T01002                                 

Gene name
Fyn, AI448320, AW552119
Definition
(RefSeq) Fyn proto-oncogene
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04360  Axon guidance
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04611  Platelet activation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04725  Cholinergic synapse
mmu05020  Prion diseases
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14360 (Fyn)
   04071 Sphingolipid signaling pathway
    14360 (Fyn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14360 (Fyn)
   04520 Adherens junction
    14360 (Fyn)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14360 (Fyn)
   04650 Natural killer cell mediated cytotoxicity
    14360 (Fyn)
   04660 T cell receptor signaling pathway
    14360 (Fyn)
   04664 Fc epsilon RI signaling pathway
    14360 (Fyn)
  09156 Nervous system
   04725 Cholinergic synapse
    14360 (Fyn)
  09158 Development and regeneration
   04360 Axon guidance
    14360 (Fyn)
   04380 Osteoclast differentiation
    14360 (Fyn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    14360 (Fyn)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14360 (Fyn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14360 (Fyn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14360 (Fyn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14360 (Fyn)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   14360 (Fyn)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    14360 (Fyn)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    14360 (Fyn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 Haspin_kinase SH3_3 zf-RING_14
Motif
Other DBs
NCBI-GeneID: 14360
NCBI-ProteinID: NP_001116365
MGI: 95602
Ensembl: ENSMUSG00000019843
Vega: OTTMUSG00000034130
UniProt: P39688
LinkDB All DBs
Structure
PDB: 

Position
10 B1; 10 20.51 cM
AA seq 537 aa AA seqDB search
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcagcgaaactgacagaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggcgtgacctccatcccgaactacaacaacttccacgcagctgggggccaggga
ctcaccgtctttgggggtgtgaactcctcctctcacactgggaccctacgcacgagagga
gggacaggagtgacactgtttgtggcgctttatgactatgaagcacggacggaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagactggtgg
gaagcccgctccttgacaaccggggaaactggttacattcccagcaattacgtggctcca
gttgactccatccaggcagaagagtggtactttggaaaacttggccgcaaagatgctgag
agacagctcctgtcctttggaaacccaagaggtacctttcttatccgcgagagcgaaacc
accaaaggtgcctactcactttccatccgtgattgggatgatatgaaaggggaccacgtc
aaacattataaaatccgcaagcttgacaatggtggatactatatcacaacgcgggcccag
tttgaaacacttcagcaactggtacagcattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaatacaaaagtagccataaagacc
cttaagccaggcaccatgtctccggagtccttcctggaggaggcgcagatcatgaagaag
ctgaagcatgacaagctggtgcagctctacgcggtcgtgtctgaggagcccatttacatc
gtcacggagtacatgagcaaaggaagtttgcttgacttcttaaaagatggtgaaggaaga
gctctgaagttgccaaaccttgtggacatggcggcacaggttgctgcaggaatggcttac
atcgagcgcatgaattatatccacagagatctgcgatcagcaaacattctagtggggaat
ggactaatttgcaagattgctgactttggattggctcggttgattgaagacaatgaatac
acagcaagacaaggtgcgaagtttcccattaagtggacagcccccgaagcggccctgtat
ggaaggttcacaatcaagtctgacgtatggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
agaggctataggatgccctgcccacaggactgcccgatctccctgcacgagctcatgatc
cactgctggaaaaaggatccggaagagcgcccgaccttcgagtacttgcagggcttcctg
gaggactactttacggccacagagccccagtatcagcccggtgaaaacctgtga

DBGET integrated database retrieval system