KEGG   Mus musculus (mouse): 14362Help
Entry
14362             CDS       T01002                                 

Gene name
Fzd1, AW227548, FZ-1, Fz1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14362 (Fzd1)
   04390 Hippo signaling pathway
    14362 (Fzd1)
   04150 mTOR signaling pathway
    14362 (Fzd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14362 (Fzd1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14362 (Fzd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14362 (Fzd1)
   05205 Proteoglycans in cancer
    14362 (Fzd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14362 (Fzd1)
   05226 Gastric cancer
    14362 (Fzd1)
   05217 Basal cell carcinoma
    14362 (Fzd1)
   05224 Breast cancer
    14362 (Fzd1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14362 (Fzd1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14362 (Fzd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14362 (Fzd1)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14362 (Fzd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 14362
NCBI-ProteinID: NP_067432
MGI: 1196625
Ensembl: ENSMUSG00000044674
Vega: OTTMUSG00000021313
UniProt: O70421
LinkDB All DBs
Position
5 A1; 5 2.61 cM
AA seq 642 aa AA seqDB search
MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRADPRRWASGLLLLLWL
LEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYLNYHFLGEKDCGAPCEPTKV
YGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAV
AVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSL
TWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVD
ALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYT
VPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSPDFTVFMI
KYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaggcggcgcctagcgagtcccgggccgccggccggctgagcttggaactt
tgtgccgaagcactcccgggccggcgggaggaggtggggcacgaggacacggccagccac
cgccgcccccgggctgatccccggcgttgggctagcgggctgctgctgctgctttggttg
ctggaggctcctctgcttttgggggtccgagcgcaggcggcgggccaggtatccgggccg
ggccagcaagccccgccgccgccccagccccagcagagcgggcagcagtacaacggcgaa
cggggcatctccatcccggaccacggctactgccagcccatctccatcccgctgtgcacg
gacatcgcgtacaaccagaccatcatgcccaacctgctgggccacacgaatcaggaggac
gccggtctggaggtgcaccagttctaccctctggtgaaggtgcagtgctccgccgagctc
aagttcttcctgtgctccatgtacgcgcctgtgtgcaccgtactggagcaggcgctaccg
ccctgccgctccctgtgcgagcgcgcacgccagggctgcgaggcgctcatgaacaagttc
ggcttccagtggccagacacactcaagtgcgagaagttcccggtgcacggcgcaggagag
ctgtgcgtgggccagaacacgtccgacaaaggcaccccaactccctccttgctaccagag
ttctggaccagtaatccgcagcacggcggcggtggttaccgcggcggctacccggggggt
gccgggacggtggagcggggaaagttctcctgcccgcgcgccctcagggtgccctcctac
ctcaactaccactttctgggggagaaggactgcggcgcaccctgcgaacccaccaaggtt
tacgggctcatgtacttcgggccagaggagctgcgcttctcgcgcacctggataggcatc
tggtccgtgctgtgctgcgcctccacgctcttcacggtgctcacgtacctagtggacatg
cggcgcttcagctacccggaacggcccatcattttcctgtccggctgttacacagcggtg
gcggtggcctacatcgctggctttctgttggaggaccgggtggtgtgcaacgacaagttt
gcagaggacggggcgcgcacggtggcgcagggcactaagaaagaaggctgcactatactc
tttatgatgctctacttcttcagcatggccagctccatctggtgggtgatcctgtccctc
acctggttcctggcagccggcatgaagtggggccacgaagccatcgaggccaactcacag
tatttccatttagccgcctgggctgtgccagccatcaaaactataaccatcttggcgttg
ggccaggtggatggcgacgtactgagcggagtgtgttttgtggggctcaacaacgtggac
gcactgcgtggctttgtgctggcgcctctcttcgtttatctgttcattggcacttctttc
ctgctggccggtttcgtgtcactcttccgcatccgcaccatcatgaagcatgacggcacc
aagacagagaagctggagaagctcatggtgcgcatcggagtcttcagtgtcctctacact
gtgccggccaccatcgtcatcgcctgctacttctatgaacaggcctttcgggaccagtgg
gagcgcagctgggtggcccagagctgcaagagttatgccatcccttgccctcacctccag
ggaggtggaggagtcccaccacacccgcccatgagcccagactttacagtcttcatgatc
aagtatctcatgacgctgattgtgggcatcacatcgggcttctggatctggtccggcaag
acactgaattcctggaggaagttctacacgaggcttaccaacagcaaacagggggagact
accgtctga

KEGG   Mus musculus (mouse): 14365Help
Entry
14365             CDS       T01002                                 

Gene name
Fzd3, AU020229, D930050A07Rik, Fz3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14365 (Fzd3)
   04390 Hippo signaling pathway
    14365 (Fzd3)
   04150 mTOR signaling pathway
    14365 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14365 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14365 (Fzd3)
  09158 Development
   04360 Axon guidance
    14365 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14365 (Fzd3)
   05206 MicroRNAs in cancer
    14365 (Fzd3)
   05205 Proteoglycans in cancer
    14365 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14365 (Fzd3)
   05226 Gastric cancer
    14365 (Fzd3)
   05217 Basal cell carcinoma
    14365 (Fzd3)
   05224 Breast cancer
    14365 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14365 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14365 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14365 (Fzd3)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14365 (Fzd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF898
Motif
Other DBs
NCBI-GeneID: 14365
NCBI-ProteinID: NP_067433
MGI: 108476
Ensembl: ENSMUSG00000007989
Vega: OTTMUSG00000020983
UniProt: Q61086
LinkDB All DBs
Position
14 D1; 14 34.09 cM
AA seq 666 aa AA seqDB search
MAVSWIVFDLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagctggattgtctttgatctttggctcttgactgtgtttctggggcagata
ggtgggcacagtttgttttcttgtgaacctataaccttgaggatgtgccaagatttgcct
tacaatactaccttcatgcctaatcttctgaaccattatgaccaacagactgcagcttta
gcaatggagcccttccaccctatggtgaacctggattgttctcgggattttcggccattt
ctttgtgcactctatgcccctatttgtatggaatatggacgtgtcacacttccctgccgt
aggctgtgtcagcgtgcctatagcgagtgttcaaaactcatggagatgtttggtgtcccg
tggcctgaagatatggagtgcagtaggtttccagattgtgatgagccatatccccgactt
gtggatttgaatttagttggagatccaactgaaggagccccagttgcagtgcagagggac
tatggtttttggtgtcccagagagttaaaaattgatcctgatcttggctattcctttctg
cacgtgcgagattgttcgccaccatgtcccaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcataggcctgatttcaatcatttgcctctctgccacattgtttact
tttttaacctttctaattgacgtcacaagattccgttaccctgaaagacctatcatattt
tatgcagtctgctacatgatggtgtcattaattttcttcattgggtttttgctggaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttctacagtgacacaagga
tctcacaataaggcctgtaccatgctctttatggtactatattttttcactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggc
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcctggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgtcggcctctacgacgttgatgcattaagatatttcgttctcgctcccctctgc
ctgtatgtggtagttggggtttctctccttttagccggcattatatccctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgatccgg
attggtgttttcagcattctctaccttgtgccactcttggttgtaattggatgttacttt
tatgagcaagcttaccgcggcatctgggagacaacatggatccaggaacgctgcagagag
tatcacattccatgtccgtaccaggttactcagatgagtcgtccagacctgattctcttt
ctgatgaagtatctcatggctctcatagttgggattccctctatattttgggttggaagc
aaaaagacatgctttgaatgggccagttttttccatgggcgtaggaaaaaagagatagtg
aatgagagccggcaggtgctccaggaacctgactttgctcagtcactcctgagggaccca
aatactccaattataagaaaatcaagaggaacttccactcaagggacatccacacatgct
tcttcaactcagctggccatggtggatgaccaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgggatggcaggtacactccctgc
agttaccgaggaatggaggagagactacctcacggcagcatgtcacggctgacggatcat
tccaggcacagtagttctcatcggctcaacgagcagtcccgacacagcagcatccgagac
ctcagtaacaaccccatgactcacattacacatggcaccagcatgaaccgtgttattgag
gaggatggaaccagtgcttag

KEGG   Mus musculus (mouse): 14366Help
Entry
14366             CDS       T01002                                 

Gene name
Fzd4, Fz4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14366 (Fzd4)
   04390 Hippo signaling pathway
    14366 (Fzd4)
   04150 mTOR signaling pathway
    14366 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14366 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14366 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14366 (Fzd4)
   05205 Proteoglycans in cancer
    14366 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14366 (Fzd4)
   05226 Gastric cancer
    14366 (Fzd4)
   05217 Basal cell carcinoma
    14366 (Fzd4)
   05224 Breast cancer
    14366 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14366 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14366 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14366 (Fzd4)
   04090 CD molecules [BR:mmu04090]
    14366 (Fzd4)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14366 (Fzd4)
CD molecules [BR:mmu04090]
 Proteins
  14366 (Fzd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF5083 Chol_subst-bind
Motif
Other DBs
NCBI-GeneID: 14366
NCBI-ProteinID: NP_032081
MGI: 108520
Ensembl: ENSMUSG00000049791
Vega: OTTMUSG00000059643
UniProt: Q61088 Q8BKU9 Q8BLL2 Q3V1B2
LinkDB All DBs
Position
7 D3; 7 49.32 cM
AA seq 537 aa AA seqDB search
MAWPGTGPSSRGAPGGVGLRLGLLLQFLLLLRPTLGFGDEEERRCDPIRIAMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcctggccgggcacagggccgagcagccggggggcgcctggaggcgtcgggctcagg
ctggggctgctgctgcagttcctcctgctcctgcggccgacactggggttcggggacgag
gaggagcggcgctgcgaccccatccgcatcgccatgtgccagaacctcggctacaacgtg
accaagatgcccaacttagtgggacacgagctgcagacagacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgcggtggcatg
tgcctttcagtcaagagacgctgtgaaccagtcctgagagaatttgggtttgcctggccc
gacaccctgaactgcagcaagttcccgccccagaacgaccacaaccacatgtgcatggaa
ggaccaggtgatgaagaggttcccttgccccacaagactcccatccagcccggggaagag
tgccactccgtgggaagcaattctgatcagtacatctgggtgaagaggagcctgaactgt
gttctcaagtgtggctacgatgctggcttgtacagccgctcagctaaggagttcacggat
atttggatggctgtgtgggccagcctctgcttcatctccaccaccttcaccgtgctgacc
ttcctgattgattcatccaggttttcttaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgttcggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcggcagagcccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagccggactcaagtggggtcatgaagccatt
gaaatgcacagttcttatttccacatcgcagcctgggctattcccgcagtgaaaaccatt
gtcatcttgattatgagactagtggatgccgatgaactgactggcttgtgctatgttggg
aaccaaaatctagatgccctcactggctttgtggtggctcctctctttacgtatttggtg
attggaacgctgttcattgcggcgggtttggtggccttattcaaaatccggtccaatctt
caaaaagacgggacaaagacagacaagttggaaaggctaatggtcaagatcggggtcttc
tcagtactgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctca
aactgggcactctttcgatattctgcagatgactcaaacatggcagttgaaatgttgaaa
atttttatgtctttgctcgtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcaaaagtgttctaaccgattggtgaattctgggaaggtaaagagagag
aagagggggaatggttgggtgaagccaggaaaaggcaacgagactgtggtataa

KEGG   Mus musculus (mouse): 14367Help
Entry
14367             CDS       T01002                                 

Gene name
Fzd5, 5330434N09Rik, AI427138, Fz-5, Fz5, mFz5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  frizzled 5/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14367 (Fzd5)
   04390 Hippo signaling pathway
    14367 (Fzd5)
   04150 mTOR signaling pathway
    14367 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14367 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14367 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14367 (Fzd5)
   05205 Proteoglycans in cancer
    14367 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14367 (Fzd5)
   05226 Gastric cancer
    14367 (Fzd5)
   05217 Basal cell carcinoma
    14367 (Fzd5)
   05224 Breast cancer
    14367 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14367 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14367 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14367 (Fzd5)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14367 (Fzd5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 14367
NCBI-ProteinID: NP_001036124
MGI: 108571
Ensembl: ENSMUSG00000045005
Vega: OTTMUSG00000047622
UniProt: Q9EQD0 Q3UEG1
LinkDB All DBs
Position
1 C2; 1 32.74 cM
AA seq 585 aa AA seqDB search
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacccgacccgtctgcgcctccctctcttctgctgctgttgctggcgcagctg
gtgggccgggcagcggccgcctccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgaggcatcggctacaacctgacgcacatgcccaaccagttcaaccatgacacgcag
gacgaagcaggcctggaggtgcaccaattctggccgcttgtggagatccactgctcaccg
gacctgcgcttcttcctgtgctctatgtacacgcccatctgtttgcctgactaccacaag
ccgctaccaccgtgccgttccgtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctccctgtgctgggc
ggcgacgccgaggttctgtgtatggattataaccgaagcgaagccaccaccgcgtcccct
aagtccttcccggccaaacctacactcccaggaccaccaggggcgccatcttccgggggc
gagtgcccctcgggaggcccatccgtgtgcacgtgccgcgagcccttcgtgcccatcctg
aaggagtcacacccactctacaacaaggtgcgcaccggccaagtgcccaactgcgcggtg
ccctgctaccagccgtccttcagcccggacgagcgcacattcgccaccttctggattggc
ctgtggtctgtgctgtgcttcatctccacgtccaccaccgttgccaccttcctcattgac
atggaacgattccgctaccctgagcgccccatcatcttcttgtctgcgtgctacctgtgt
gtgtcactgggattcttggtgcgcctggtagtgggccatgccagcgtcgcttgcagccgt
gagcacagccacattcactatgagactaccggccctgcgctgtgcacggttgtcttcctc
ttagtctatttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaatgaagccatcgcaggttatgcacagtacttc
caccttgctgcctggctcatccccagtgtcaagtccattacggcgctggcactgagctcg
gtggacggggacccagtggctggcatctgctatgtgggcaaccaaaacctgaactcacta
cgaggctttgtcttgggcccactggtgctgtacctgttggtgggcacgctcttccttctg
gcaggcttcgtgtcactcttccgcatccggagcgtcatcaagcagggtggcactaagacg
gacaagctagagaagctcatgatccgcatcggcatcttcaccctgctctacacggtgcca
gccagcatcgtggtggcctgctacctgtatgagcagcactaccgggagagctgggaggca
gccctcacctgcgcgtgtccgggaccggacgctggccagccacgcgccaaacccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggcaagactctggagtcttggcggcggttcaccagccgctgctgctgcagc
tctcggcggggccacaagagcggtggcgctatggccgcaggagactatgcggaggccagc
gccgcgctcaccggcaggaccgggccgcctggccccaccgccgcataccacaagcaagtg
tccctgtcgcacgtatag

KEGG   Mus musculus (mouse): 14368Help
Entry
14368             CDS       T01002                                 

Gene name
Fzd6, Fz6
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14368 (Fzd6)
   04390 Hippo signaling pathway
    14368 (Fzd6)
   04150 mTOR signaling pathway
    14368 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14368 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14368 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14368 (Fzd6)
   05205 Proteoglycans in cancer
    14368 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14368 (Fzd6)
   05226 Gastric cancer
    14368 (Fzd6)
   05217 Basal cell carcinoma
    14368 (Fzd6)
   05224 Breast cancer
    14368 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14368 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14368 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14368 (Fzd6)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14368 (Fzd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Mid1 Folate_rec DUF898 Integrin_alpha RseC_MucC
Motif
Other DBs
NCBI-GeneID: 14368
NCBI-ProteinID: NP_001155966
MGI: 108474
Ensembl: ENSMUSG00000022297
UniProt: Q61089 Q542J1 Q3UTZ0
LinkDB All DBs
Position
15 B3.1; 15 15.22 cM
AA seq 709 aa AA seqDB search
MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQGIAAVEMGH
FLHLANLECSPNIEMFLCQAFIPTCTEQIHVVLPCRKLCEKIVSDCKKLMDTFGIRWPEE
LECNRLPHCDDTVPVTSHPHTELSGPQKKSDQVPRDIGFWCPKHLRTSGDQGYRFLGIEQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHGAPGPHRLKVISKSMGTSTGATTNHGTSAMAIADHDYLGQETSTEVHTSPEASVKEG
RADRANTPSAKDRDCGESAGPSSKLSGNRNGRESRAGGLKERSNGSEGAPSEGRVSPKSS
VPETGLIDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGAGSHSDA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggtccccgtttctgttggcgtgcattcttctgcccctcgtaagaggacacagc
cttttcacctgtgagccaatcaccgttcccagatgtatgaaaatgacttacaacatgacg
ttcttccctaacctgatgggtcattatgaccaggggatcgctgctgtggaaatggggcac
tttctgcatcttgcaaatctagaatgttcaccaaacattgaaatgttcctttgccaagct
tttataccaacctgcacagagcaaattcatgtagttctaccctgtcggaaattgtgtgag
aaaatagtttctgattgcaaaaaactaatggacacttttggcatccgatggcctgaagaa
cttgaatgtaacagattgccacactgtgatgacactgttcctgtaacttctcatccacac
acagagctttctgggccacagaagaaatcagatcaagtcccaagagacattggattttgg
tgtccaaagcaccttaggacttccggggaccaaggctataggtttctgggaattgaacag
tgtgcccctccgtgccccaatatgtattttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactctgttcacgttccttacattt
ttaattgacgttagacgattcagatacccagagagaccaattatctattactctgtctgc
tacagcattgtctctctcatgtacttcgtggggtttttgctgggcaatagcacggcttgt
aataaggcagacgagaagctggagctcggggacaccgttgtcctagggtcaaagaataag
gcttgcagtgtggtatttatgtttctgtatttttttacaatggctggcaccgtgtggtgg
gtgattctcaccattacgtggttcttagctgccgggagaaaatggagttgcgaagctatt
gaacaaaaagcagtgtggttccatgccgttgcctggggggcgcccgggttcctgaccgtc
atgctgctcgctatgaataaggttgaaggagacaacattagcggcgtttgcttcgttggc
ctgtatgacctggacgcctctcgctacttcgtccttctgcctctgtgcctctgcgtattt
gttgggctgtctctcctcttagccggcatcatctccttgaatcatgtccgacaagtcata
cagcatgatggccggaaccaagagaagctaaagaaattcatgattcgcatcggagtcttc
agtggcctgtatcttgtgcccttagtgacacttctcggttgctatgtctatgagctagtg
aacaggatcacctgggagatgacatggttctctgatcattgtcaccagtaccgcatcccg
tgcccttaccaggcaaatccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctttaagcgaaaccgcaagcgagaccccatcagtgagagccgc
cgagtgctgcaagagtcctgtgagttcttcctgaagcacaactctaaagtgaagcacaag
aagaagcatggcgcaccagggcctcataggctgaaggtcatttccaagtccatgggaact
agcacaggagcgaccacaaatcatggcacctctgccatggcaatcgctgaccatgattac
ttagggcaagaaacttcaacagaagtccacacctccccagaagcatccgtcaaagaggga
cgagcagaccgagcaaacactcccagcgccaaagatcgggactgtggggaatctgcaggg
cccagttccaagctctctgggaaccggaacggcagggaaagccgagcgggcggcctgaag
gagagaagcaatggatcagagggggctccaagtgaaggaagggtaagtccaaagagcagc
gttcctgagactggcctgatagactgcagcacttcacaggccgccagttctccagaacca
accagcctcaagggctccacatctctgcctgttcactcagcttccagagctaggaaagag
cagggtgctggcagccattccgacgcttga

KEGG   Mus musculus (mouse): 14369Help
Entry
14369             CDS       T01002                                 

Gene name
Fzd7, Fz7
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14369 (Fzd7)
   04390 Hippo signaling pathway
    14369 (Fzd7)
   04150 mTOR signaling pathway
    14369 (Fzd7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14369 (Fzd7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14369 (Fzd7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14369 (Fzd7)
   05205 Proteoglycans in cancer
    14369 (Fzd7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14369 (Fzd7)
   05226 Gastric cancer
    14369 (Fzd7)
   05217 Basal cell carcinoma
    14369 (Fzd7)
   05224 Breast cancer
    14369 (Fzd7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14369 (Fzd7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14369 (Fzd7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14369 (Fzd7)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14369 (Fzd7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 14369
NCBI-ProteinID: NP_032083
MGI: 108570
Ensembl: ENSMUSG00000041075
Vega: OTTMUSG00000020777
UniProt: Q61090 Q810L8 Q9CUZ6
LinkDB All DBs
Position
1 C2; 1 30.08 cM
AA seq 572 aa AA seqDB search
MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccccggcacggcggcgtcgcactcgcccctgggcctctgcgccctggtgctt
gctcttctgggcgcgctgcccacggacacccgggctcagccatatcacggcgagaaaggc
atctcggtaccggaccacggcttctgccagcccatctccatcccgttgtgcacggatatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctaccctctggtaaaggtgcagtgttctcctgagctacgcttc
ttcttatgctctatgtacgcacccgtgtgcaccgtgctcgaccaagccattcctccgtgc
cgttccttgtgcgagcgcgcccgacagggctgcgaggcgctcatgaacaagttcggcttc
cagtggccagagcggttgcgctgcgagaacttcccagtgcacggtgccggcgagatctgc
gtggggcagaacacgtccgacggctccgggggcgcgggcggcagtcccaccgcctaccct
actgctccctacctgccagacccacctttcactgcgatgtccccctcagatggcagaggc
cgcttgtctttccccttctcgtgtccgcgccagctcaaggtgcccccctacctgggctac
cgcttcctaggtgagcgtgactgcggtgccccgtgtgagccgggccgtgctaacggcctc
atgtactttaaagaagaggagagacggttcgcccgcctctgggtgggtgtgtggtcagtg
ctgtgctgcgcctcgacgctcttcacggtgctcacctacctagtggacatgcgtcgcttc
agctatccagagcgacccatcatcttcctgtcgggttgctacttcatggtggcagtggcg
cacgtggcaggcttcctgctagaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggtatggccagctccatctggtgggtcattctgtccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggccaactcgcagtactttcat
ctggccgcgtgggctgtgccagcggtcaagacaatcaccattttggccatgggccaggtg
gatggtgacctactcagtggagtgtgctacgtgggcctgtctagtgtggatgcattgcgg
ggcttcgtgctggcgcccttgttcgtctacctcttcatcgggacgtccttcctgttggcc
ggctttgtgtctctctttcgcatccgcaccatcatgaagcacgacggcaccaagacagag
aagctggagaagctgatggtgcgcatcggcgtcttcagcgtgctctacacggtgccggcc
accatcgtgttggcctgctacttttatgagcaggccttccgagagcactgggaacgcacc
tggctcctgcagacttgcaagagctacgctgtgccctgccctccgggccacttctctccc
atgagccccgactttacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actacgggcttctggatctggtcgggcaagaccctgcagtcatggcgtcgcttctaccac
agactcagccacagcagcaagggggaaactgcggtatga

KEGG   Mus musculus (mouse): 14370Help
Entry
14370             CDS       T01002                                 

Gene name
Fzd8, Fz8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14370 (Fzd8)
   04390 Hippo signaling pathway
    14370 (Fzd8)
   04150 mTOR signaling pathway
    14370 (Fzd8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14370 (Fzd8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14370 (Fzd8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14370 (Fzd8)
   05205 Proteoglycans in cancer
    14370 (Fzd8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14370 (Fzd8)
   05226 Gastric cancer
    14370 (Fzd8)
   05217 Basal cell carcinoma
    14370 (Fzd8)
   05224 Breast cancer
    14370 (Fzd8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14370 (Fzd8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14370 (Fzd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14370 (Fzd8)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14370 (Fzd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 14370
NCBI-ProteinID: NP_032084
MGI: 108460
Ensembl: ENSMUSG00000036904
UniProt: Q61091
LinkDB All DBs
Structure
PDB: 

Position
18 A1; 18 4.91 cM
AA seq 685 aa AA seqDB search
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSG
SGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGA
AGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWF
LAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLR
GFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTV
PAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGV
WVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDV
STGLTWRSGTASSVSYPKQMPLSQV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctcctagccgccttggcggtgctacag
cgctctagcggcgctgccgcggcttcggccaaggagctggcgtgccaagagatcacggtg
ccgttgtgcaaaggcatcggttacaactacacttacatgcccaaccagttcaaccacgac
acgcaagatgaggcgggcctagaggtgcaccagttttggccgctggtggagatacagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaagcctctgccgccttgtcgctctgtgtgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcttggcctgaccgcatgcgctgcgatcggttgccggag
cagggcaacccggacactctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgcctccgccgcctcctcccggcgagcagccgccctctggc
agcggccacagccgcccgccaggggccaggcccccacatcgtggcggcagcagtaggggc
agcggggacgcggcggctgcgcccccttcgcgcggcgggaaggcgaggccccctggtggc
ggcgctgctccctgcgagccggggtgccagtgccgcgcgcccatggtgagcgtgtccagc
gaacgccacccgctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccc
tgccacaaccccttctttagccaggatgagcgcgccttcaccgtcttctggatcggcctg
tggtcggtgctctgcttcgtctccaccttcgccactgtctctaccttcctcatcgatatg
gagcgctttaagtacccggaacggcccatcatattcctctccgcctgttacctcttcgtg
tctgtcgggtacctggtgcgcctggtggcaggacatgagaaagtggcctgcagcggcggc
gctccgggtgctggcggagctgggggtgcgggcggcgcggcggcggctggcgcaggggca
gcgggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagctgggtgcagtc
gagcagcatgttcgctatgaaaccactggccccgcgctgtgcacggtggtctttctcctt
gtctacttttttggcatggccagctccatctggtgggtaatcctgtcgctcacgtggttc
ttggcagctggcatgaagtggggtaatgaggccatagcaggctactcgcagtacttccac
ctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctcagctccgta
gacggcgacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgc
ggctttgtgctggcgccactggttatctacctcttcattgggactatgtttctgttagct
ggcttcgtgtcgctgttccgaatccgttcagtcatcaagcagcaaggaggcccaactaag
acacacaagctagaaaaactcatgatccgcttgggcctcttcaccgtgctctacacggtg
cccgctgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccgcgctgggag
gccacgcacaactgcccatgccttcgggacctgcaaccggaccaggctcgcaggcccgat
tacgcggtcttcatgctcaagtacttcatgtgcctagtagtgggcatcacatcgggcgtg
tgggtctggtccggcaagactctggagtcctggcgcgcgttgtgcactaggtgctgctgg
gccagcaagggcgctgcagtaggcgcgggcgctggaggcagcggccctgggggcagtgga
cccgggcccggcggaggtgggggacacggcggaggcgggggatccctctacagcgacgtc
agtaccggcctgacgtggcggtctggcacggccagctctgtatcttaccctaagcaaatg
ccattgtcccaggtctga

KEGG   Mus musculus (mouse): 14371Help
Entry
14371             CDS       T01002                                 

Gene name
Fzd9, Fz9, mfz9
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14371 (Fzd9)
   04390 Hippo signaling pathway
    14371 (Fzd9)
   04150 mTOR signaling pathway
    14371 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14371 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14371 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14371 (Fzd9)
   05205 Proteoglycans in cancer
    14371 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14371 (Fzd9)
   05226 Gastric cancer
    14371 (Fzd9)
   05217 Basal cell carcinoma
    14371 (Fzd9)
   05224 Breast cancer
    14371 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14371 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14371 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14371 (Fzd9)
   04090 CD molecules [BR:mmu04090]
    14371 (Fzd9)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14371 (Fzd9)
CD molecules [BR:mmu04090]
 Proteins
  14371 (Fzd9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 14371
NCBI-ProteinID: NP_034376
MGI: 1313278
Ensembl: ENSMUSG00000049551
Vega: OTTMUSG00000021311
UniProt: Q9R216
LinkDB All DBs
Position
5 G2; 5 75.08 cM
AA seq 592 aa AA seqDB search
MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
LRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRP
ARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWS
ALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAG
ALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFH
MAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLT
GFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLR
ATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQS
LCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccaccgctgctccgcggggcgctgctgctgtggcagctgctggcgacgggc
ggcgcggcgctggagatcggccgcttcgatccggagcgtggccgtggccccgcaccgtgc
caagcgatggagatccccatgtgccggggcattggctacaacctgacccgcatgcccaac
ctactgggccacacgtcgcagggcgaggcggcggcgcagctggccgagttctcgcccctc
gtgcagtacggctgccacagccacctgcgcttcttcctctgctcgctctacgccccaatg
tgcaccgaccaggtctccactcccatcccagcctgccggcccatgtgcgagcaggctcgc
ctgcgctgcgcccccatcatggagcaattcaatttcggctggcccgactcactcgactgt
gcccggctccccacgcgcaacgacccgcacgcactctgtatggaggcacccgagaacgct
acagcaggccccacagaaccccacaagggcctgggcatgctccctgtggcacctcggccc
gcgaggccaccgggagattcagccccaggtcccggcagcggtggcacctgcgacaacccc
gagaagttccagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccaggcgtc
gaggtgttctggtctcggcgcgataaggacttcgcgctggtttggatggctgtgtggtcc
gcgttgtgtttcttctccacggccttcaccgtgttcaccttcctgctggagcctcaccgg
ttccagtacccagagcgcccgattatcttcctttctatgtgctacaatgtctactccttg
gccttcctgatcagagcggtggcaggtgcacagagtgtggcatgcgaccaggaggcaggg
gctctgtatgtgatccaggagggtctggaaaacacaggctgcaccctggtcttcctgttg
ctctattatttcgggatggccagctcactttggtgggtggttttgactctaacctggttc
ctggctgcaggcaaaaaatggggccacgaggccatcgaggctcacggcagctacttccac
atggcagcgtggggcctgccagcactcaaaactatcgtggtcctgactctgcgcaaggtg
gctggcgatgaactgactgggctctgctatgtagccagcatggacccggcagccctcact
ggctttgtgttggtacccctatcttgctacctggtactgggtaccagtttcctcctgacc
ggttttgtggctctcttccatatccgcaaaatcatgaagacgggaggcaccaatacggag
aagctggagaagctgatggtcaaaatcggagtcttttccatcctttacacagtgccggcc
acctgcgtcattgtctgctacgtttatgaacgcctcaacatggacttctggcggcttcgg
gccacagagcaaccatgtactgctgccaccgtgcctggaggccggagagactgctcgctg
ccagggggctcggtgcccactgtggctgtcttcatgctcaaaatcttcatgtccttggtg
gtgggcatcaccagtggagtctgggtatggagttccaagacttttcagacttggcagagc
ctgtgctaccgaaaaatggcagctggccgagcccgggccaaggcctgccgaaccccaggg
ggctatggccggggtacccactgccactacaaagcccccacggtggtcttgcacatgact
aagacagacccctctctggagaaccccacacacctctag

KEGG   Mus musculus (mouse): 57265Help
Entry
57265             CDS       T01002                                 

Gene name
Fzd2, AL033370, AW456835, Fz10, Fzd10, Mfz10, Mfz10a
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    57265 (Fzd2)
   04390 Hippo signaling pathway
    57265 (Fzd2)
   04150 mTOR signaling pathway
    57265 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    57265 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    57265 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    57265 (Fzd2)
   05205 Proteoglycans in cancer
    57265 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    57265 (Fzd2)
   05226 Gastric cancer
    57265 (Fzd2)
   05217 Basal cell carcinoma
    57265 (Fzd2)
   05224 Breast cancer
    57265 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    57265 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    57265 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    57265 (Fzd2)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  57265 (Fzd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 57265
NCBI-ProteinID: NP_065256
MGI: 1888513
Ensembl: ENSMUSG00000050288
Vega: OTTMUSG00000002949
UniProt: Q9JIP6
LinkDB All DBs
Position
11; 11 E1
AA seq 570 aa AA seqDB search
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPSGLQPG
AGGTPGGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcctgctgctgccactgctg
ctgctgccggccgccggaccggcccagttccacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttcttggccacacgaaccaggaagacgcgggcctggaggtgcatcag
ttctacccgctggtgaaggtgcagtgctcgcccgagctgcgcttcttcctgtgctccatg
tacgcgccggtgtgcacagtgctggagcaggccatcccgccgtgccgctccatctgcgag
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccaatggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggagcagatctgcgtgggccagaaccac
tcggaggacggagctcctgcgctactcaccaccgcgccaccttctgggctgcagcccggc
gcgggtggcaccccgggcggccctggcggtggtggctcgccaccgcgttacgccactctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctgggtgagcgcgattgtgccgcgccctgcgagcccgcacggcccgacggctctatgttc
ttctcgcaagaggagactcgttttgcccgtctctggatcctcacatggtcggtgttgtgc
tgcgcttccactttcttcacggtcaccacctatttagtggacatgcagcgatttcgctac
ccagagcggcccatcatctttctgtccggctgctacaccatggtgtcagtggcctacatt
gcgggcttcgttctccaggagcgcgtggtatgcaatgagcgcttctcagaggacggttat
cgcacggtggtgcagggcactaagaaagaaggctgcactatactcttcatgatgctctac
ttcttcagcatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccggaatgaagtggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcctgggccgtgccggccgtcaaaaccatcaccatcttggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaatagcctggacccgctgcggggcttc
gtgctggcgccgctcttcgtatacctgttcatcggtacatccttcctgctggccggcttc
gtgtcactcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctg
gagaggctcatggtgcgcattggcgtcttctcggtgctctacacggtaccggccaccatc
gtcatcgcctgctacttctatgagcaggccttccgcgagcactgggagcgctcctgggta
agccagcactgcaagagcctagccatcccctgcccggcccactacacgccccgcatgtcg
cccgacttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacactgcactcgtggaggaagttctacactcgtctc
accaacagccggcatggcgagaccactgtgtga

KEGG   Mus musculus (mouse): 93897Help
Entry
93897             CDS       T01002                                 

Gene name
Fzd10, Fz-10
Definition
(RefSeq) frizzled class receptor 10
  KO
K02842  frizzled 9/10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    93897 (Fzd10)
   04390 Hippo signaling pathway
    93897 (Fzd10)
   04150 mTOR signaling pathway
    93897 (Fzd10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    93897 (Fzd10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    93897 (Fzd10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    93897 (Fzd10)
   05205 Proteoglycans in cancer
    93897 (Fzd10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    93897 (Fzd10)
   05226 Gastric cancer
    93897 (Fzd10)
   05217 Basal cell carcinoma
    93897 (Fzd10)
   05224 Breast cancer
    93897 (Fzd10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    93897 (Fzd10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    93897 (Fzd10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    93897 (Fzd10)
   04090 CD molecules [BR:mmu04090]
    93897 (Fzd10)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  93897 (Fzd10)
CD molecules [BR:mmu04090]
 Proteins
  93897 (Fzd10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 93897
NCBI-ProteinID: NP_780493
MGI: 2136761
Ensembl: ENSMUSG00000081683
Vega: OTTMUSG00000027707
UniProt: Q8BKG4 Q149J3
LinkDB All DBs
Position
5; 5 G1.3
AA seq 582 aa AA seqDB search
MQHPGPRLWLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHE
NQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSP
IMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQE
HPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCF
FSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYV
IQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAW
AIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVA
LFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQH
KCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGL
KRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacccgggcccgcgcctgtggctggtgctgcaggtgatgataggctcgtgcacg
gccatcagctccatggacttagagcgccctggagacggcaagtgccagccggtggagatt
cccatgtgcaaggacatcggctacaacaccacccgcatgcccaacctgatgggtcacgag
aaccagcgcgaggcggccatccaactgcacgagttcgcgccgctcgtggagtacggctgc
cacagccaccttcgcttcttcctgtgttcgctgtacgcgcccatgtgcaccgagcaggtc
tccacacccatccctgcttgccgggtcatgtgcgagcaggcccggctcaagtgctcgccg
atcatggagcagttcaaattcaggtggccggactccctggattgcagcaagctccccaac
aagaacgaccccaactacctgtgcatggaggcacccaacaacggctcggatgagcccagc
cggggctctggcatgtttcctccgctcttcaggccccagaggccccacagcgcgcaggag
cacccactaaaggacgggggtccggggcgcgcaggttgtgacaacccaggcaagttccac
catgtggagaagagcgaatcttgcgcaccgctttgcactccgggggtggatgtgtattgg
agccgcgacgacaagcgcttcgctgtggtctggctggccatctggtccgtgctgtgcttc
ttctccagcgccttcaccgtgctcaccttcctcatcgacccatcgcgcttcaggtacccc
gaacgtcctatcatcttcctctccatgtgctactgcgtttattcggtgggctatatcatc
cgcctcttcgcgggcgcggagagcatcgcttgtgaccgggacagtgggcagctgtatgtt
atccaggaaggactggagagcacgggctgtaccttagtcttcttggtactttactacttc
ggcatggccagctctttatggtgggtggtcctcaccctcacttggttcctggctgctgga
aagaagtggggccatgaggccattgaagccaacagcagctactttcacctggcagcttgg
gccatcccggctgtgaagactatcttgatcttggtgatgcgcagggtggcaggggatgag
ctcactggtgtgtgttatgtgggcagcatggatgtcaatgctctgaccggcttcgtgctg
gtcccgctggcttgctacctagtcatcggcacttccttcatcctgtccggctttgtggct
ttattccacatccggagggtgatgaaaacgggtggggagaacacggacaagctggagaag
ctcatggtacgcataggggtcttctccctcctctacactgtgccggccacctgtgtgatt
gcctgctatttttatgaacgcctcaacatggactactggaagatgctggccacccagcac
aagtgtaagatgaacaatcagaccaagacacctgactgcctgatgaccacctccatccct
gccgtggaggtcttcatggtcaaagtgtccatgctgctggtggtgggcatcaccagtggg
gtgtgggtctggacttccaagaccctgcagtcctggcaacacgtatgcagccgggggcta
aagagaaaaagccggaggaaaccagccagtgtggtcaccagtgcagggatctacaaaaaa
gcccagcacccccaaaaacctcaccttgggaagtatgaactgcccgcccagccttcagcc
tgcgtgtga

DBGET integrated database retrieval system