KEGG   Mus musculus (mouse): 14387Help
Entry
14387             CDS       T01002                                 

Gene name
Gaa, E430018M07Rik
Definition
(RefSeq) glucosidase, alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    14387 (Gaa)
   00500 Starch and sucrose metabolism
    14387 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    14387 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14387 (Gaa)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     14387 (Gaa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14387 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 14387
NCBI-ProteinID: NP_001152796
MGI: 95609
Ensembl: ENSMUSG00000025579
Vega: OTTMUSG00000003997
UniProt: P70699
LinkDB All DBs
Position
11 E2; 11 83.35 cM
AA seq 953 aa AA seqDB search
MNIRKPLCSNSVVGACTLISLTTAVILGHLMLRELMLLPQDLHESSSGLWKTYRPHHQEG
YKPGPLHIQEQTEQPKEAPTQCDVPPSSRFDCAPDKGISQEQCEARGCCYVPAGQVLKEP
QIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLH
FKIKDPASKRYEVPLETPRVLSQAPSPLYSVEFSEEPFGVIVRRKLGGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLGEHLSPLMLSTDWARITLWNRDTPPSQGTNLYGSHPFYLA
LEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDS
FADFPDMVRELHQDGRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCPNNELEN
PPYVPGVVGGILQAATICASSHQFLSTHYNLHNLYGLTEAIASSRALVKTRGTRPFVISR
STFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVR
WTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRG
DTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSV
DSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQ
PMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL
QLREVTVLGVATAPTQVLSNGIPVSNFTYSPDNKSLAIPVSLLMGELFQISWS
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacggaagcccctctgttcgaactccgtggttggggcctgcacccttatctct
ctgactacagcggtcatcctgggtcatctcatgcttcgggagttaatgctgcttccccaa
gaccttcatgagtcctcttcaggactgtggaagacgtaccgacctcaccaccaggaaggt
tacaagccagggcctctgcacatccaggagcagactgaacagcccaaagaagcacccaca
cagtgtgatgtgccccccagcagccgctttgactgtgcccccgacaaaggcatctcacag
gagcaatgcgaggcccgcggctgctgctatgtcccagcagggcaggtgctgaaggagccg
cagatagggcagccctggtgtttcttccctcccagctacccaagctaccgtctagagaac
ctgagctctacagagtcggggtacacagccaccctgacccgtaccagcccgaccttcttc
ccaaaggatgtgctgaccttacagctggaggtgctgatggagacagacagccgcctccac
ttcaagatcaaagatcctgctagtaagcgctacgaagtgcccctggagaccccacgtgtg
ctgagccaggcaccatccccactttacagcgtggaattctcagaggaaccctttggagtg
atcgttcgtaggaagcttggtggccgagtgttgctgaacacaaccgtggcccccctgttc
ttcgctgaccagttcctgcagctgtccacttccctgccctcccagcacatcacaggcctg
ggggaacacctcagcccactcatgctcagcaccgactgggctcgtatcaccctctggaac
cgggacacaccaccctcgcaaggtaccaacctctacgggtcacatcctttctacctggca
ctggaggacggtggcttggctcacggtgtcttcttgctaaacagcaatgccatggatgtc
atcctgcaacccagcccagccctaacctggaggtcaacgggcgggatcctggatgtgtat
gtgttcctaggcccagagcccaagagcgttgtgcaacaatacctggatgttgtgggatac
cccttcatgcctccatactggggcctcggcttccacctctgccgctggggctactcctcg
accgccattgtccgccaggtagtggagaacatgaccaggacacacttcccgctggacgtg
caatggaatgacctggactacatggacgcccgaagagacttcaccttcaaccaggacagc
tttgccgacttcccagacatggtgcgggagctgcaccaggatggccggcgctacatgatg
atcgtggaccctgccatcagcagcgcaggccctgctgggagttacaggccctacgacgag
ggtctgcggaggggcgtgttcatcaccaacgagactgggcagccgctgattgggaaggtt
tggcctggaaccaccgccttccctgatttcaccaaccctgagacccttgactggtggcag
gacatggtgtctgagttccacgcccaggtgcccttcgatggcatgtggctcgacatgaac
gaaccgtccaacttcgttagaggctctcagcagggctgccccaacaatgaactggagaac
cccccctatgtgcccggggtggttggcgggatcttgcaggcagccaccatctgtgcctcc
agccaccaattcctctccacacactacaacctccacaacctgtacggcctcactgaagct
atcgcctccagcagggccctggtcaagactcggggaacacgaccctttgtgatctcccgc
tcaaccttctcgggccacggccggtacgctggtcactggacaggggatgtgcggagctct
tgggagcatcttgcatactctgtgccagacatcctgcagttcaacctgctgggcgtgccc
ctggtcggggcggacatctgcggcttcataggagacacgtcagaagagctgtgtgtgcgc
tggacccagttgggggccttctaccccttcatgcggaaccacaatgacctgaatagcgtg
cctcaggagccgtacaggttcagcgagacggcgcagcaggccatgaggaaggccttcgcc
ttacgctatgcccttctgccctacctgtacactctcttccaccgcgcccacgtcagagga
gacacggtggcccggcccctcttcctggagttccctgaggatcccagcacctggtctgtg
gaccgccagctcttgtgggggccggccctgctcatcacacctgtgcttgagcctgggaaa
actgaagtgacgggctacttccccaagggcacgtggtacaacatgcagatggtgtcagtg
gattccctcggtactctcccttctccatcatcggcttcatccttcagatctgctgtccag
agcaaggggcagtggctgacactggaagccccactggataccatcaacgtgcacctgagg
gaggggtacatcataccgctgcagggtcccagcctcacaaccacggagtcccgaaagcag
cccatggctctggctgtggcattaacagcaagcggcgaggccgatggggagctgttctgg
gacgacggggagagcctcgcggttctggagcgtggggcctacacactggtcaccttctca
gccaagaacaataccattgtgaacaagttagtgcgtgtgaccaaggagggagctgagcta
caactgagggaggtgaccgtcttgggagtggccacagctcctacccaggtcctttccaac
ggcatccctgtctccaatttcacctacagccctgacaacaagagcctggccatccctgtc
tcactgctgatgggagagctgtttcaaatcagctggtcctag

DBGET integrated database retrieval system