KEGG   Mus musculus (mouse): 14415Help
Entry
14415             CDS       T01002                                 

Gene name
Gad1, EP10, Gad-1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00410  beta-Alanine metabolism
mmu00430  Taurine and hypotaurine metabolism
mmu00650  Butanoate metabolism
mmu01100  Metabolic pathways
mmu04727  GABAergic synapse
mmu04940  Type I diabetes mellitus
Module
mmu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    14415 (Gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14415 (Gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    14415 (Gad1)
   00430 Taurine and hypotaurine metabolism
    14415 (Gad1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14415 (Gad1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14415 (Gad1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     14415 (Gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 14415
NCBI-ProteinID: NP_032103
MGI: 95632
Ensembl: ENSMUSG00000070880
Vega: OTTMUSG00000033269
UniProt: P48318 Q548L6
LinkDB All DBs
Position
2 C2; 2 41.63 cM
AA seq 593 aa AA seqDB search
MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKS
RLVSAFRERQSSKNLLSCENSDQGARFRRTETDFSNLFAQDLLPAKNGEEQTAQFLLEVV
DILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVR
TGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSN
KDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAAL
GFGTDNVILIKCNERGKIIPADLEAKILDAKQKGYVPLYVNATAGTTVYGAFDPIQEIAD
ICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQIN
KCLELADYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPK
IKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccactccttcgcctgcaacctcctcgaacgcgggagcggatcctaatact
accaacctgcgccctacaacgtatgatacttggtgtggcgtagcccatggatgcaccaga
aaactgggcctgaagatctgtggcttcttacaaaggaccaatagcctggaagagaagagt
cgtcttgtgagcgccttcagggagaggcagtcctccaagaacctgctttcctgtgaaaac
agtgaccagggtgcccgcttccggcgcacagagaccgacttctccaacctgtttgctcaa
gatctgcttccagctaagaacggggaggagcaaactgcgcagttcttgctggaagtggta
gacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggttctggatttc
caccacccacaccagttgctggaaggcatggaaggctttaatttggagctgtctgaccac
cccgagtctctggagcagatcctggttgactgtagagacaccctgaagtacggggttcgc
acaggtcaccctcgatttttcaaccagctctctactggtttggatatcattggtttagct
ggtgaatggctgacatcgactgccaataccaatatgttcacatatgaaattgcacccgtg
tttgttctcatggaacagattactcttaagaagatgagagagatcgttggatggtcaaat
aaagatggtgatgggatattttctcctgggggagccatatccaatatgtacagcatcatg
gctgctcgttacaagtacttcccagaagtgaagacaaaaggcatggcggctgtgcccaaa
ctggtcctcttcacctcagaacacagtcactattccataaagaaagccggggctgcgctt
ggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataattccg
gctgatttagaggcaaaaattcttgatgccaaacaaaagggctatgttcccctttatgtc
aatgcaaccgcaggcacgactgtttacggagcattcgatccaatccaggaaattgcggac
atatgtgagaaatacaacctttggctgcatgtggatgctgcctggggtggtggactgctc
atgtcccggaagcaccgccacaaactcagcggcatagaaagggccaattcagtcacctgg
aaccctcacaagatgatgggcgtgctgctccagtgctctgccattctggtcaaggaaaag
ggtatactccaaggatgcaaccagatgtgtgcaggctacctcttccagccagacaagcag
tatgacgtctcctatgacaccggggacaaggcgattcagtgtggccgccatgtggacatc
ttcaagttctggctgatgtggaaagcaaagggcaccgtgggatttgaaaaccagatcaac
aaatgcctggagctggctgattacctctacgccaagattaaaaacagagaagagtttgag
atggttttcgatggtgagcctgagcacacaaatgtctgtttctggtacattccacaaagc
cttcgaggggttccagatagccctgagcgacgagaaaagctacacagggtggctcccaag
atcaaagctctgatgatggagtcaggaacaaccatggtgggctaccagcctcaaggggac
aaggccaacttcttccggatggtcatctctaacccagccgccacccagtctgacatcgat
ttcctcattgaggagatagagaggttgggtcaggatctgtaa

DBGET integrated database retrieval system