KEGG   Mus musculus (mouse): 14580Help
Entry
14580             CDS       T01002                                 

Gene name
Gfap, AI836096
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    14580 (Gfap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14580 (Gfap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    14580 (Gfap)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    14580 (Gfap)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     14580 (Gfap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head DUF1664 Spc7 Jnk-SapK_ap_N DUF4407
Motif
Other DBs
NCBI-GeneID: 14580
NCBI-ProteinID: NP_034407
MGI: 95697
Ensembl: ENSMUSG00000020932
Vega: OTTMUSG00000003084
UniProt: P03995
LinkDB All DBs
Position
11 E1; 11 66.48 cM
AA seq 430 aa AA seqDB search
MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGALNAGFK
ETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELREL
RLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLAR
VDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYE
AVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTN
ESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEI
ATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKD
SKQEHKDVVM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggagcggagacgcatcacctctgcgcgccgctcctatgcctccgagacggtggtcagg
ggcctcggtcctagtcgacaactgggtaccatgccacgcttctccttgtctcgaatgact
cctccactccctgccagggtggacttctccctggccggggcgctcaatgctggcttcaag
gagacacgggcgagcgagcgtgcagagatgatggagctcaatgaccgctttgctagctac
atcgagaaggtccgcttcctggaacagcaaaacaaggcgctggcagctgaactgaaccag
cttcgagccaaggagcccaccaaactggctgatgtctaccaggcggagcttcgggagctg
cggctgcggctggaccagcttacggccaacagtgcccggctggaggtggagagggacaac
tttgcacaggacctcggcaccctgaggcagaagctccaagatgaaaccaacctgaggctg
gaggcagagaacaacctggctgcgtatagacaggaggcagatgaagccaccctggctcgt
gtggatttggagagaaaggttgaatcgctggaggaggagatccagttcttaaggaagatc
tatgaggaggaagttcgagaactccgggagcagctggcccaacagcaggtccacgtggag
atggatgtggccaagccagacctcacagcggccctgagagagattcgcactcaatacgag
gcagtggccaccagtaacatgcaagagacagaggagtggtatcggtctaagtttgcagac
ctcacagacgctgcgtcccgcaacgcagagctgctccgccaagccaagcacgaagctaac
gactatcgccgccaactgcaggccttgacctgcgatctggagtccctgcgcggcacgaac
gagtccctagagcggcaaatgcgcgaacaggaagagcgccatgcgcgggagtcggccagt
taccaggaggcacttgctcggctggaggaggagggccaaagcctcaaggaggagatggcc
cgccacctgcaggagtaccaggatctactcaacgttaagctagccctggacatcgagatc
gccacctacaggaaattgctggagggcgaagaaaaccgcatcaccattcctgtacagact
ttctccaacctccagatccgagaaaccagcctggacaccaaatccgtgtcagaaggccac
ctcaagaggaacatcgtggtaaagactgtggagatgcgggatggtgaggtcattaaggac
tcgaagcaggagcacaaggacgtggtgatgtga

DBGET integrated database retrieval system