KEGG   Mus musculus (mouse): 14632Help
Entry
14632             CDS       T01002                                 

Gene name
Gli1, AV235269, Zfp-5, Zfp5
Definition
(RefSeq) GLI-Kruppel family member GLI1
  KO
K16797  zinc finger protein GLI1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14632 (Gli1)
   04024 cAMP signaling pathway
    14632 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14632 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14632 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14632 (Gli1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14632 (Gli1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Motif
Other DBs
NCBI-GeneID: 14632
NCBI-ProteinID: NP_034426
MGI: 95727
Ensembl: ENSMUSG00000025407
UniProt: P47806
LinkDB All DBs
Position
10 D3; 10 74.5 cM
AA seq 1111 aa AA seqDB search
MFNPMTPPQVNSYSEPCCLRPLHSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGAARETS
SCTEGSLFPPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSP
GGSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTRGSMMLHPQSRGPRATC
QLKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGREDLEREEKPEPESVYETDC
RWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTG
EKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHS
NEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKRE
REGGSGREESRLTVPESAMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDL
SSLDEGPCVSATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVS
LDRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENGASSLPGLTPAQHYMLRARYASARG
SGTPPTAAHSLDRMGGLSVPPWRSRTEYPGYNPNAGVTRRASDPARAADHPAPARVQRFK
SLGCVHTPPSVATGRNFDPHHPTSVYSPQPPSITENVAMDTRGLQEEPEVGTSVMGNGLN
PYMDFSSTDTLGYGGPEGTAAEPYEARGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPEN
WGEFPSHAGVYPSNKAPGAAYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSE
GSPGPQPLFSHHPQLPQPQYPQSGPYPQPPHGYLSTEPRLGLNFNPSSSHSTGQLKAQLV
CNYVQSQQELLWEGRNRGGLPNQELPYQSPKFLGGSQVSQSPAKTPAAAAAAYGSGFAPA
SANHKSGSYPAPSPCHETFTVGVNRPSHRPAAPPRLLPPLSPCYGPLKVGDTNPSCGHPE
VGRLGAGPALYPPPEGQVCNALDSLDLDNTQLDFVAILDEAQGLSPPLSHEQGDSSKNTP
SPSGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatccaatgactccaccacaagtcaatagctatagtgagccatgctgtctccga
cccctccacagccaaggagtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaactttatgtcagggtcccagggttatggagcagccagagagaccagc
agctgcactgaaggatctctctttcctcctcctcctcctcctcggagttcagtcaaatta
acaaagaagcgggctctctccatctcgcccctttctgatgccagcctcgacctgcaaacc
gtaatccggacctcacccagctccctggtggctttcatcaactctcgctgtacatctccg
ggcggttcctacggccatctctccattggtaccatgagcccttctttaggattcccacct
cagatgagtcatcaaaaaggaacttcacctccctatggagtccagccctgtgtaccacat
gactctactcggggttcaatgatgcttcacccccagtcccggggaccacgtgcaacctgc
cagctgaagtcagagctggatatgatggttggcaagtgcccggaggaccctttggaaggg
gacatgtctagccccaactccacaggcacacaggatcacctgttggggatgctggatggg
cgggaggacctggagagagaggagaagcctgagcctgagtctgtgtatgagacagactgc
cgctgggatggttgcagccaggagttcgattcccaggagcagctggtgcaccacatcaac
agtgagcatatccacggggagcggaaggaattcgtgtgccattggggaggttgctccagg
gagctgaggcccttcaaggcccaatacatgctggtggtgcacatgcgcagacacacgggc
gagaagccacacaagtgcacgtttgaaggctgtcggaagtcctattcacgccttgaaaac
ctcaagacgcaccttcggtcgcacacgggtgagaagccttacatgtgtgagcaagaaggt
tgcagcaaggcctttagcaatgccagtgaccgcgccaagcaccagaatcggacccactcc
aatgagaagccatacgtgtgcaagctccccggctgcaccaagcgctacacagatcccagc
tcgctccgcaaacacgtgaagacagtgcatggtccggatgcccacgtgaccaagcggcat
cgaggggatggccccttgccacgggctcagcccctctccacagtggagcccaagcgggaa
agggaaggaggatccggcagggaagagagcagactgactgtgcccgagagtgccatgccg
cagcagagccccggagcgcagtcctcttgcagcagcgaccactccccagcaggcagtgcg
gccaacacggacagcggcgtggagatggccggcaacgccgggggcagcactgaggacttg
tccagcttggatgaaggaccttgtgtctcggccaccggactctccacgcttcgccgcctg
gagaaccttaggctggatcagctgcatcagctccggcccatagggtctcggggtctcaaa
ctgcccagcttaacccacgctggcgcacctgtgtctcgccgtctgggccccccagtctcc
ctggaccgccgcagcagcagctccagcagcatgagctctgcttacacagtcagccgcagg
tcctccctggcatcccctttcccgccgggaaccccaccagagaatggggcatcgtcacta
cctggcctcacacctgctcagcactacatgctccgtgccagatatgcttcagccaggggg
agtggcaccccgcccactgcagctcacagcctggatcggatgggaggtctttctgttcct
ccttggagaagccgaaccgagtacccgggatacaacccaaatgcaggggtcactcggagg
gccagtgacccagcccgggctgctgaccacccagctccagccagagtccagcggttcaag
agcctgggatgtgtccacacgccccctagtgtggcaacgggacggaacttcgatccccac
caccctacctctgtctattcgccacagccccccagcatcaccgaaaatgttgccatggat
actagggggctacaggaggagccagaggttggaacttctgtgatgggcaatggtctgaac
ccatacatggatttttcctccactgatactctgggatatgggggacccgaggggacggca
gctgagccttatgaagctaggggtccaggttccctgcctcttgggcctggtccaccaacc
aactatggccctggccactgtgcccagcaggtctcctatcctgatcccaccccagaaaac
tggggtgagttcccttctcatgctggggtgtaccctagcaataaggctccgggtgctgcc
tatagccagtgtcctcgacttgagcattatggacaagtgcaggtaaaaccagaacaaggg
tgcccagtggggtctgactccaccggattggcaccctgcctcaatgcccaccccagtgaa
gggtccccaggcccgcagcctctgttttcacatcatccccagctccctcagccccagtat
ccccagtcgggtccctatcctcagcctccccatggttatctctcaacagaacccaggctt
ggcctcaatttcaacccctcctcctctcattccacaggacagctcaaagctcagctggtg
tgtaattacgttcagtcgcagcaggaattgttgtgggagggaagaaaccggggagggctc
cccaaccaggaactcccataccagagccccaagtttctggggggttcccaagttagtcag
agccctgccaagaccccagcagcagcggcggcagcatatggatctggctttgcacctgct
tcggccaatcacaaatcaggctcctatcctgccccttcaccctgccatgaaactttcacc
gtgggagtaaacaggccttcccacaggccagcagcaccaccccgacttctgcccccgctg
tccccttgctatgggcccctcaaggtgggggataccaaccccagctgtggccatcctgag
gtgggcaggttaggagcaggccctgccttgtaccctcctcctgaagggcaggtgtgtaac
gctctggactctcttgacctggacaacactcagctggactttgtggctatcctagatgag
gcccagggcctgagccctcctctttcccatgagcaaggggacagctctaaaaacacccca
tctccctctgggccccccaacatggcagtgggtaacatgagtgtcttgctggggtctctg
cctggagagacacaattcctcaactctagtgcctaa

DBGET integrated database retrieval system