KEGG   Mus musculus (mouse): 14632Help
Entry
14632             CDS       T01002                                 

Gene name
Gli1, AV235269, Zfp-5, Zfp5
Definition
(RefSeq) GLI-Kruppel family member GLI1
  KO
K16797  zinc finger protein GLI1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14632 (Gli1)
   04024 cAMP signaling pathway
    14632 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14632 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14632 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14632 (Gli1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14632 (Gli1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Motif
Other DBs
NCBI-GeneID: 14632
NCBI-ProteinID: NP_034426
MGI: 95727
Ensembl: ENSMUSG00000025407
UniProt: P47806
LinkDB All DBs
Position
10 D3; 10 74.5 cM
AA seq 1111 aa AA seqDB search
MFNPMTPPQVNSYSEPCCLRPLHSQGVPSMGTEGLSGLPFCHQANFMSGSQGYGAARETS
SCTEGSLFPPPPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSP
GGSYGHLSIGTMSPSLGFPPQMSHQKGTSPPYGVQPCVPHDSTRGSMMLHPQSRGPRATC
QLKSELDMMVGKCPEDPLEGDMSSPNSTGTQDHLLGMLDGREDLEREEKPEPESVYETDC
RWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTG
EKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHS
NEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAQPLSTVEPKRE
REGGSGREESRLTVPESAMPQQSPGAQSSCSSDHSPAGSAANTDSGVEMAGNAGGSTEDL
SSLDEGPCVSATGLSTLRRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVS
LDRRSSSSSSMSSAYTVSRRSSLASPFPPGTPPENGASSLPGLTPAQHYMLRARYASARG
SGTPPTAAHSLDRMGGLSVPPWRSRTEYPGYNPNAGVTRRASDPARAADHPAPARVQRFK
SLGCVHTPPSVATGRNFDPHHPTSVYSPQPPSITENVAMDTRGLQEEPEVGTSVMGNGLN
PYMDFSSTDTLGYGGPEGTAAEPYEARGPGSLPLGPGPPTNYGPGHCAQQVSYPDPTPEN
WGEFPSHAGVYPSNKAPGAAYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSE
GSPGPQPLFSHHPQLPQPQYPQSGPYPQPPHGYLSTEPRLGLNFNPSSSHSTGQLKAQLV
CNYVQSQQELLWEGRNRGGLPNQELPYQSPKFLGGSQVSQSPAKTPAAAAAAYGSGFAPA
SANHKSGSYPAPSPCHETFTVGVNRPSHRPAAPPRLLPPLSPCYGPLKVGDTNPSCGHPE
VGRLGAGPALYPPPEGQVCNALDSLDLDNTQLDFVAILDEAQGLSPPLSHEQGDSSKNTP
SPSGPPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatccaatgactccaccacaagtcaatagctatagtgagccatgctgtctccga
cccctccacagccaaggagtccccagcatgggaacagaaggactttctggtctgcccttt
tgccaccaagccaactttatgtcagggtcccagggttatggagcagccagagagaccagc
agctgcactgaaggatctctctttcctcctcctcctcctcctcggagttcagtcaaatta
acaaagaagcgggctctctccatctcgcccctttctgatgccagcctcgacctgcaaacc
gtaatccggacctcacccagctccctggtggctttcatcaactctcgctgtacatctccg
ggcggttcctacggccatctctccattggtaccatgagcccttctttaggattcccacct
cagatgagtcatcaaaaaggaacttcacctccctatggagtccagccctgtgtaccacat
gactctactcggggttcaatgatgcttcacccccagtcccggggaccacgtgcaacctgc
cagctgaagtcagagctggatatgatggttggcaagtgcccggaggaccctttggaaggg
gacatgtctagccccaactccacaggcacacaggatcacctgttggggatgctggatggg
cgggaggacctggagagagaggagaagcctgagcctgagtctgtgtatgagacagactgc
cgctgggatggttgcagccaggagttcgattcccaggagcagctggtgcaccacatcaac
agtgagcatatccacggggagcggaaggaattcgtgtgccattggggaggttgctccagg
gagctgaggcccttcaaggcccaatacatgctggtggtgcacatgcgcagacacacgggc
gagaagccacacaagtgcacgtttgaaggctgtcggaagtcctattcacgccttgaaaac
ctcaagacgcaccttcggtcgcacacgggtgagaagccttacatgtgtgagcaagaaggt
tgcagcaaggcctttagcaatgccagtgaccgcgccaagcaccagaatcggacccactcc
aatgagaagccatacgtgtgcaagctccccggctgcaccaagcgctacacagatcccagc
tcgctccgcaaacacgtgaagacagtgcatggtccggatgcccacgtgaccaagcggcat
cgaggggatggccccttgccacgggctcagcccctctccacagtggagcccaagcgggaa
agggaaggaggatccggcagggaagagagcagactgactgtgcccgagagtgccatgccg
cagcagagccccggagcgcagtcctcttgcagcagcgaccactccccagcaggcagtgcg
gccaacacggacagcggcgtggagatggccggcaacgccgggggcagcactgaggacttg
tccagcttggatgaaggaccttgtgtctcggccaccggactctccacgcttcgccgcctg
gagaaccttaggctggatcagctgcatcagctccggcccatagggtctcggggtctcaaa
ctgcccagcttaacccacgctggcgcacctgtgtctcgccgtctgggccccccagtctcc
ctggaccgccgcagcagcagctccagcagcatgagctctgcttacacagtcagccgcagg
tcctccctggcatcccctttcccgccgggaaccccaccagagaatggggcatcgtcacta
cctggcctcacacctgctcagcactacatgctccgtgccagatatgcttcagccaggggg
agtggcaccccgcccactgcagctcacagcctggatcggatgggaggtctttctgttcct
ccttggagaagccgaaccgagtacccgggatacaacccaaatgcaggggtcactcggagg
gccagtgacccagcccgggctgctgaccacccagctccagccagagtccagcggttcaag
agcctgggatgtgtccacacgccccctagtgtggcaacgggacggaacttcgatccccac
caccctacctctgtctattcgccacagccccccagcatcaccgaaaatgttgccatggat
actagggggctacaggaggagccagaggttggaacttctgtgatgggcaatggtctgaac
ccatacatggatttttcctccactgatactctgggatatgggggacccgaggggacggca
gctgagccttatgaagctaggggtccaggttccctgcctcttgggcctggtccaccaacc
aactatggccctggccactgtgcccagcaggtctcctatcctgatcccaccccagaaaac
tggggtgagttcccttctcatgctggggtgtaccctagcaataaggctccgggtgctgcc
tatagccagtgtcctcgacttgagcattatggacaagtgcaggtaaaaccagaacaaggg
tgcccagtggggtctgactccaccggattggcaccctgcctcaatgcccaccccagtgaa
gggtccccaggcccgcagcctctgttttcacatcatccccagctccctcagccccagtat
ccccagtcgggtccctatcctcagcctccccatggttatctctcaacagaacccaggctt
ggcctcaatttcaacccctcctcctctcattccacaggacagctcaaagctcagctggtg
tgtaattacgttcagtcgcagcaggaattgttgtgggagggaagaaaccggggagggctc
cccaaccaggaactcccataccagagccccaagtttctggggggttcccaagttagtcag
agccctgccaagaccccagcagcagcggcggcagcatatggatctggctttgcacctgct
tcggccaatcacaaatcaggctcctatcctgccccttcaccctgccatgaaactttcacc
gtgggagtaaacaggccttcccacaggccagcagcaccaccccgacttctgcccccgctg
tccccttgctatgggcccctcaaggtgggggataccaaccccagctgtggccatcctgag
gtgggcaggttaggagcaggccctgccttgtaccctcctcctgaagggcaggtgtgtaac
gctctggactctcttgacctggacaacactcagctggactttgtggctatcctagatgag
gcccagggcctgagccctcctctttcccatgagcaaggggacagctctaaaaacacccca
tctccctctgggccccccaacatggcagtgggtaacatgagtgtcttgctggggtctctg
cctggagagacacaattcctcaactctagtgcctaa

KEGG   Mus musculus (mouse): 14633Help
Entry
14633             CDS       T01002                                 

Gene name
Gli2
Definition
(RefSeq) GLI-Kruppel family member GLI2
  KO
K16798  zinc finger protein GLI2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14633 (Gli2)
   04390 Hippo signaling pathway
    14633 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14633 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14633 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14633 (Gli2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14633 (Gli2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 14633
NCBI-ProteinID: NP_001074594
MGI: 95728
Ensembl: ENSMUSG00000048402
Vega: OTTMUSG00000034815
UniProt: Q0VGT2 A5AA27 Q8BKI7
LinkDB All DBs
Position
1 E2.3; 1 52.17 cM
AA seq 1544 aa AA seqDB search
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPI
DMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNP
HMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMTLMA
SHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDASLD
LQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQR
GLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNCLNDANQNKQNSESAVS
STVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCH
WADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGE
KPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNEASA
EPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNN
DSGMEMPGTGPGSLGDLTALADTCPGADTSALAAPSTGGLQLRKHMSTVHRFEQLKREKL
KSLKDSCSWAGPAPHTRNTKLPPLPVNGSVLENFNNTGGGGPAGLLPSQRLPELTEVTML
SQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYDPIS
TDASRRSSEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRTRLA
LLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYAGAAPAFPHEGPNSSTRRASDPVR
RPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSVDSNLTRNAYSPRPPSINEN
VVMEAVAAGVDGPGLECDLGLVEDELVLPDDVVQYIKAHTGGTLDDGIRQGYPTEGTGFP
ENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNEVSSGTV
DALPTQVKPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAPSAS
RGSYTQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNIVSGSLNQFSPSCSNMAAKP
SHLGLPQQMEVVPNATIMNGHQREHGVPNSSLAAVSQPHPVLSYPQQDSYQQGSNLLSSH
QPGFMESQQNAGFGLMQPRPPLEPNTASRHRGVRSGQQQLYARTTGQAMVTSANQETAEA
MPKGPAGTMVSLAPQPSQDTGRAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQACSDS
IQPEPLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSS
RLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atggagacttctgccccagcccctgcactggagaagaaagaagccaagagtggtctcttg
gaggacagcagcttccccgacccagggaaaaaggcctgtcctctggcggtggccgcagct
gtagccgcccacggagttcctcagcagctcctgccggctttccacgcgcctttgccgatt
gacatgagacaccaggagggaaggtaccattatgaccctcactctgtccacagtgtacac
gggcctcccaccctaagtggcagccctgtcatctcagatatctccttgatacgactttct
ccacaccctgctggccctggagagtcacccttcagcgcccaccacccctacgtgaacccc
catatggagcactacctccggtctgtgcacagcagccccacactctcaatgatctctgcc
gccaggggcctcagccctgctgatgtggcccacgaacatctgaaagagaggggactcttt
agcctcgcagccccaggcaccaacccttcagactattaccaccagatgaccctcatggca
agccaccccaccccttatggggaccttctaatgcagagcgggggtgctgctagcgcaccc
catctccatgactacctcaaccctgtggatgcatcacgattctctagtccacgtgtgacc
ccacgactgagccgcaagcgggctctgtccatctccccgctctcagatgccagcctcgac
ctacaacgcatgattcggacctctcccaactcgctggtagcttacatcaacaactccagg
agcagctcagcagccagtggctcttatggacatctgtctgctggtgccctcagcccagcc
ttcacttttccccaccccatcaatcctgtggcctaccagcagatcctgagccagcagcgg
ggcctgggctcagcctttggacacacaccacccctgatccagccttcacccaccttcttg
gcccagcagcccatgactctcacctccatcagcaccatgcctacccaactcagcagcagt
agcagcaactgtctaaatgatgccaaccagaacaagcagaacagcgagtcagctgtgagc
agcaccgtgaaccccatcaccattcataagcggagcaaggtcaagactgaggctgagggc
ctgcgtccagcatccccgcttggactgacacaggagcagctggccgatctcaaggaagac
ctggacagggatgactgtaagcaggaggccgaggtggtcatctacgagaccaactgccac
tgggcagactgcaccaaggagtatgacacacaggagcagctggtgcatcatatcaacaat
gaacacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgagagag
cagaagcccttcaaggcccagtacatgctggttgttcacatgcgcagacacacgggtgag
aagccacacaagtgcacgttcgaaggctgttccaaggcctactctcgcctggagaacctg
aagacacacctgcgttcacacacaggagagaagccatatgtgtgtgaacacgaaggctgt
aacaaagccttctccaatgcctcagaccgcgccaagcaccagaaccgcactcactccaat
gagaaaccctacatctgcaagatcccaggctgcaccaagaggtacacagaccccagctca
ctccgcaagcatgtgaagactgtccatgggccagacgcccatgtcaccaagaaacagcgt
aatgatgtgcatgtccgtgctccactgctcaaggagaatggggataatgaggccagcgcc
gagccaggtggccggggacctgaggagagtgtggaggccagtagcaccagccacactgtg
gaggactgcctacatatcaaagccatcaagacagagagctccgggctttgtcagtccagc
cccggggcccagtcatcctgcagcagcgagccctctcccctgggcagtgcccccaacaat
gacagtggcatggagatgccggggacagggcctgggagtctgggagacctgacagcactg
gctgacacgtgtccaggagctgacacctcagccctggctgcaccctccactggtggcctg
cagctgcgcaaacacatgagcaccgtgcatcgctttgagcagctgaagagagagaagctc
aagtcactgaaggattcctgctcgtgggccggcccagctccacacacccgcaacaccaag
ctgcctccccttccagtcaatggttctgtcctggaaaacttcaacaatacagggggcggt
ggaccggcaggactgctgcccagccagcggctaccagagctgaccgaagtgacgatgctg
agccagctgcaggaacgaagagacagctccaccagcaccatgagctcggcctacactgtg
agccgccgctcctctggcatctccccatacttctctagccgtcgctccagcgaggcttcg
cctctcggtggcctacgcccgcacaacgccagctcagcagactcctatgaccccatctcc
acagatgcctctcggcgctccagtgaagccagccagtgcagtggcggtggcccagggctg
ctcaacctcacacctgcgcagcagtacaacctgcgtgccaagtacgcagcggccacaggt
ggaccaccgcccacgccactgccgggcctcgatcgtgtaagccttcgtacccgcctggcc
ttgctggatgctcctgagcgtgcacttcctggtgcctgcccacatccactggggccacgg
cgtggcagcgatgggcctacctatagccatggtcatggccatggctacgcaggtgcggct
ccagcattcccccacgaggggccaaacagcagcacacggcgggccagcgaccctgtgcgg
cgccctgacccccttattctgcctcgagtgcaacgtttccacagtacccacaacatgaat
ccaggttcactgccaccctgcgctgatcggcgtggcctgcacgtacagagccaccccagc
gtagacagcaacctgacccgcaacgcctactctcccagaccccctagcatcaatgagaac
gtggtgatggaggccgtggctgctggggtagacggcccagggctagagtgcgacctgggg
ctggtggaggatgagctggtgctgccagatgatgtggtacagtacatcaaggctcacacc
ggtggtaccttggatgacggcattcggcaggggtatcccacagaaggtactggcttcccc
gagaactctaagctgcccagtcctgggctacaaggccaccgcaggctagcagctgccgac
tccaacatgggtccttctgctcctggactcgggggctgccagctgagctacagcccctcc
tccaacctcaacaagagcaacatgcctgtgcagtggaatgaggtgagttctggcaccgtg
gatgccctgcctacccaggtgaagccacctcctttccctcacagcaacctggctgtggtc
caacagaagccagcctttggccagtatccaggatataatccacaatccgtgcagagcagc
tccggaggtctagacagcacccagccgcacctacagcttcgaggagccccctctgcatca
agagggagctacacgcaacagcctcgacagccagctgcaggcagtcagtgcctgggtatg
agtgcggccatgagcccgcaggccagctacagccaagcccacccccagctgagcccaaac
attgtcagcggatctctgaaccagttttctccctcctgcagcaatatggcagccaagccc
agccacctgggactccctcagcaaatggaagttgtccccaatgccaccatcatgaatggc
catcaacgggagcacggggtccccaattcatccctggctgcggtgtcacaacctcaccca
gtcctgagctatccccagcaggacagctaccaacagggctccaaccttctgtcatcccat
cagcctggcttcatggagtcccagcagaacgcgggctttggtctcatgcagcctcggcca
cccctggaacccaacacggccagccgtcaccgtggagtacgttctgggcaacagcagttg
tatgccaggaccactggccaagccatggtcacatcagccaaccaagagacagcagaagct
atgcccaagggaccagcagggaccatggtatccctagctcctcagccatctcaggacaca
gggcgggcacaagatcagaacacgctatactactatggccagatccacatgtatgaacag
aatggaggctgcccagccgtgcagccccagccgccacaaccacaagcttgctcagacagt
atccagcctgagcctttgccttcaccgggagtcaaccaggtgtctagcaccgtggactcc
cagctcctggagcccccccagattgactttgatgccatcatggatgatggtgatcactcg
agtttgttttctggtgcactgagcccaacccttctccacaatctctcccagaattcctca
cgcctcaccacaccccggaattccttgacactgccctccatccctgcgggcatcagcaac
atggccgtgggcgacatgagttccatgctcaccagcctggctgaagagagcaagttttta
aacatgatgacctaa

KEGG   Mus musculus (mouse): 14634Help
Entry
14634             CDS       T01002                                 

Gene name
Gli3, AI854843, AU023367, Bph, GLI3-190, GLI3FL, Pdn, Xt, add
Definition
(RefSeq) GLI-Kruppel family member GLI3
  KO
K06230  zinc finger protein GLI3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14634 (Gli3)
   04024 cAMP signaling pathway
    14634 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14634 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14634 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14634 (Gli3)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14634 (Gli3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 14634
NCBI-ProteinID: NP_032156
MGI: 95729
Ensembl: ENSMUSG00000021318
Vega: OTTMUSG00000024401
UniProt: Q61602 B2RUG4 Q3TYX7
LinkDB All DBs
Position
13 A1; 13 5.43 cM
AA seq 1583 aa AA seqDB search
MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITM
QPQSVQGLNKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEADKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRSDLSGVDFTV
LNTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTKMALL
GEGRDSGVTLPPVHPPRRCSDGGGHTYRGRHLMPHDALANSVRRASDPVRTVSENMSLAR
VQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQESSQPRYFQASPCPPSITENVALEALTM
DADANLNDEDLLPDDVVQYLNSQNQTGYGQQLQSGISEDSKVAHEPEDLDLAGLPDSHVG
QEYPALEQPCSEGSKTDLPIQWNEVSSGTSDLSSSKLKCGQQRPSAQQPRGFGLYNNMVV
HPHNLWKVGTGPAGGYQTLGENSSTYNGPEHFAIHSGDGLGTNGNTFHEQPFKTQQYGSQ
LNRQPLTSSALDHACGTGIQGSKLKGNSLQENGGLLDFSLSVAPNELAGNTVNGMQTQDQ
MGQGYIAHQLLSGSMQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDNSSQPSSM
AAIRGYQPCASYGGNRRQAMPRGNLTLQQGQLSDMSQSSRVNSIKMEAQGQSQQLCSTVQ
NYSGQFYDQTMGFSQQDRKAGSFSLSDANCLLQGNGTENSELLSPGANQVTSTVDSFESH
DLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMGTTNM
AIGDMSSLLTSLAEESKFLAVMQ
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccaggcccacagctctacggcgactgagaggaagaaagctgaaaattccatt
gggaaatgtcccacgagaacagatgtcagcgagaaggccgtggcctctagtaccacttcc
aatgaggatgaaagtcctggacagatctatcaccgagagagaagaaacgcaatcactatg
cagcctcagagtgtgcagggtctcaacaaaatcagtgaggagccctcgacgtctagtgat
gagagggcctcgctgatcaagaaagagatccatggctctctaccacatctggcggagccc
tctctcccttaccgtgggactgtgtttgccatggatccccggaatggctacatggagcct
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattatgatccatctcctattcctccattacatgtgccttct
gccttatctagtagcccgacgtatccagacttgcccttcattaggatctccccacaccgt
aatcccactgcagcctcagagtcccccttcagccccccacacccctacatcaacccatat
atggactacatccgctcattgcacagcagcccatccctctccatgatctctgctgcccga
gggctgagccctacagatgctccccatgctggagtcagccctgcggaatactatcaccag
atggctctgctgacaggccagcgcagcccttatgcagacatccttccctcagctgccact
gctggtgcaggggccatccatatggagtaccttcatgccatggacagcaccagatttccc
agccctaggctgtcagctaggcccagccgaaagcgcacactgtcaatatcgccactgtca
gatcatagcttcgaccttcagaccatgataagaacatcccctaactccttggttacaatc
ctcaataattcccgtagcagctcttcagcaagtggttcctatgggcacttatcggcaagt
gcaatcagccctgcattgagcttcacctacccctccgctcctgtgtctcttcacatgcat
caacagatcctaagccgacagcaaagcttaggctccgcattcggacacagccctcctctc
atccaccctgctccaacatttccaacacagagacctatccctgggattccgacagttctg
aaccccgtccaggtcagctctggcccttctgagtcctcacagagcaagcccacaagcgag
tctgcagtgagcagcactggtgaccctatgcataataagcggtccaagatcaagcctgat
gaagacctccccagcccagggtcacggggccagcaggaacagccggaaggaacaacccta
gtcaaggaggaagcggacaaagatgaaagcaagcaggagcctgaagtcatctacgagaca
aactgccactgggaaggctgcaccagagagttcgacacccaagatcagcttgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagttcgtgtgccgctggcttgattgt
tcacgagagcagaaaccgttcaaagcccagtacatgttggtagtgcatatgagaagacac
actggggagaagcctcacaaatgtacatttgaaggttgcacaaaagcctactcaagactc
gaaaacctgaaaacccacttgagatctcacactggagagaagccatacgtctgtgagcat
gagggctgcaacaaggctttctctaatgcttcagatcgggccaagcaccaaaacagaaca
cattccaatgagaaaccgtatgtatgcaaaatccctggctgcaccaagcgttacacagac
cccagctctctccggaaacacgtgaagactgtgcatggccctgaggctcatgttaccaag
aagcagcgtggggacatgcaccctcggcctccacccccgagagattccggcagccattca
cagtccaggtcccctggccggccaactcagggagcatttggtgagcagaaggagctgagc
aacactacctcaaagcgggaagagtgcctccaggtgaagactgtcaaggctgagaagccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgactgatggaggtagtgtagcagac
ctcagtgccatcgatgaaaccccaatcatggactcgaccatttccacggcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcacatcaaactt
gaaaggctaaaacaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtatctcctctcataggaaatggcacacagtccaataacaactatagctcg
ggtgggcccgggaccctcctcccgagcagaagtgacctgtcaggtgtagacttcacagtg
ctgaacacactcaacaggagagacagcaataccagcactatcagctctgcctacctgagc
agccgcagatcctcgggcatctccccctgcttttccagccgcaggtccagcgaggcgtcc
caggctgaagggcgaccccagaatgtgagtgtggctgactcctacgatcccatctccaca
gatgcttcaaggaggtccagcgaggccagccagggtgacgggctgcccagtctgctcagc
ctcacacccgtgcagcagtaccgccttaaggccaagtatgcagctgccacaggtggccca
ccacccacacctctgccccacatggagaggctgagcctgaagaccaagatggccttgcta
ggggaagggagggactctggggtgaccctgcctccagtccatcctcctcgaagatgcagt
gatgggggaggtcacacatacagagggcgtcacctgatgcctcatgatgcactagcgaac
agtgtgaggagagccagcgaccctgtgaggacagtctcggagaacatgtcacttgccagg
gttcaacgcttcagcagcctcaatagctttaatcctccaaatttgcctccatcggtggaa
aagcgtagcttagtgctgcaaaattatacccggcaggagagcagccaaccccggtacttc
caggcatccccttgccctcccagcatcacagagaatgttgccctggaggctctgaccatg
gatgctgatgctaacttgaatgatgaagacctcctgccagatgatgtggtacagtattta
aattcccagaaccaaacagggtatgggcagcagttgcagagtggcatctctgaagacagc
aaagtagcccatgagccagaggacttggacttagcagggctgccagacagtcatgttggc
caggagtacccagctctggagcagccctgctctgagggcagtaaaactgatttgcccatc
cagtggaacgaggtcagttctggaacttctgatctgtcatcctccaagctgaagtgtggt
cagcagcgccctagcgcacagcagcctcggggttttgggctatacaacaatatggtggta
cacccacataatctgtggaaggttggcactggcccagctgggggatatcagaccctcggg
gagaatagcagtacctacaatggcccagagcactttgcaatccacagtggggatggactt
ggcaccaatggaaatactttccatgaacagccctttaagacccagcagtatgggagccag
ctcaacaggcagccactgacttccagtgctctagatcatgcctgtggtacagggattcaa
gggtccaagctaaaaggcaacagcttgcaagagaatgggggtttgctagatttcagcctg
tccgtggcaccaaatgagttagctggcaacacagtgaatggcatgcaaacccaagatcaa
atgggacagggatacattgcccatcagctactcagtggcagcatgcaacaccaggggccc
agccgccctggtcaacaggtactagggcaggttggtgctacctcacatatcaacatctat
caagggacagagagctgcctaccagggactcaggacaacagcagccagccatcaagcatg
gcagctatcaggggctaccagccctgtgccagctatgggggtaacaggcgtcaggcaatg
ccaaggggcaacctcactctgcaacaaggacagctcagtgacatgagtcagagcagcagg
gtgaacagcatcaaaatggaggcacaaggtcagtcccagcagctctgctctaccgtgcag
aattattccggtcagttctatgaccaaaccatgggcttcagtcagcaagacaggaaagct
ggctcgttctccctctcagatgccaactgcctgctccaagggaatggcactgaaaactct
gagttactctccccaggtgctaaccaggtaacaagcacagttgacagctttgagagtcat
gacctagaaggtgtgcagattgattttgatgccatcatagatgatggggaccataccagc
ctaatgtcaggggccttgagcccaagtattattcagaacctttcccacagctcctcccgt
ctcaccactccgcgggcatccctcccattcccatccctatccatgggcaccaccaacatg
gctatcggggatatgagttctttgctgacctcccttgcagaagaaagcaagttccttgca
gttatgcagtag

DBGET integrated database retrieval system