KEGG   Mus musculus (mouse): 14660Help
Entry
14660             CDS       T01002                                 

Gene name
Gls, 6330442B14, AI314027, B230365M23Rik
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00471  D-Glutamine and D-glutamate metabolism
mmu01100  Metabolic pathways
mmu04724  Glutamatergic synapse
mmu04727  GABAergic synapse
mmu04964  Proximal tubule bicarbonate reclamation
mmu05206  MicroRNAs in cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14660 (Gls)
   00220 Arginine biosynthesis
    14660 (Gls)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    14660 (Gls)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    14660 (Gls)
  09156 Nervous system
   04724 Glutamatergic synapse
    14660 (Gls)
   04727 GABAergic synapse
    14660 (Gls)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    14660 (Gls)
   05230 Central carbon metabolism in cancer
    14660 (Gls)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     14660 (Gls)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 14660
NCBI-ProteinID: NP_001074550
MGI: 95752
Ensembl: ENSMUSG00000026103
Vega: OTTMUSG00000021410
UniProt: D3Z7P3
LinkDB All DBs
Structure
PDB: 

Position
1 C1.1; 1 26.86 cM
AA seq 674 aa AA seqDB search
MMRLRGSAMLRELLLRPPAAVGAVLRRAQPLGTLCRRPRGGSRPTAGLVAAARLHPWWGG
GGRAKGPGAGGLSSSPSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAF
GNSEGKEMVAAGDNKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRL
KECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELY
ESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAI
AVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKF
DYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYF
QLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFH
VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRH
FAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAA
EGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDG
KGNQTVHKNLDGLL
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctacgggagctgctcttaaggccgcccgccgcc
gtcggagccgtcctgcggcgcgcgcagcccctcggcacgctgtgccggcgcccccggggc
gggagccggccgaccgctggcctggtggccgctgcgcgactccacccgtggtggggcggg
ggcggccgcgcgaagggccccggcgcgggcggcctgtccagttcgccctcggagatccta
caggagctggggaaggggggtacgccgccacagcagcagcagcagcagcagcagcagcca
ggggcgtcgccacccgcagccccgggccccaaggacagcccgggggagaccgacgcgttc
ggcaacagcgagggcaaggagatggtggccgcgggcgacaataaaataaaacagggtctg
ttacctagcttggaagatttgctgttctatacaattgcagaaggacaagaaaagatacct
gttcacaagtttattacagcactcaaatctacaggattgcgaacatctgatcccaggttg
aaagagtgtatggatatgttaagattaactcttcagacaacgtcagatggtgtcatgcta
gacaaagatctttttaaaaagtgtgttcaaagcaacattgttttgttgacacaagcattt
agaagaaagtttgtcattcctgactttatgtcttttacctcacacatcgatgagttatat
gaaagtgctaaaaagcagtctggagggaaggttgctgattatattcctcagctggccaaa
ttcagtcctgatttgtggggtgtatctgtctgtactgtagatgggcaaaggcattctatt
ggagataccaaagttcctttttgtcttcagtcctgtgtaaaacccctgaaatatgcaatt
gctgttaatgacctgggaactgagtatgtacatcgctatgttgggaaggagccaagtgga
ttaagattcaacaaactctttttgaatgaagatgataaaccacataatcctatggtaaat
gctggagcaattgttgtgacttctctaataaagcaaggagtaaataatgctgagaagttt
gactacgtgatgcaatttttgaataagatggctggtaatgaatatgttggattcagtaat
gcaacgtttcagtctgaacgagaaagtggagatcgaaattttgcaataggatattactta
aaagaaaagaagtgttttccagaaggcacagacatggttgggatactagatttttacttc
cagctgtgctctattgaagtgacatgtgaatcagcaagtgtgatggctgccaccttggct
aatggtggtttctgcccaattactggtgaaagagtcctcagtcctgaggcagttcggaat
acactgagcttgatgcattcttgtggcatgtatgacttctcagggcagtttgcgttccat
gttggtcttcctgcaaaatctggagttgctgggggtattcttttagttgtccccaacgtc
atgggcatgatgtgttggtctcctcctcttgacaagatgggcaacagtgttaagggaatt
cacttttgtcacgatcttgtttctctgtgtaacttccataactatgataatttgagacac
tttgcaaaaaaacttgatcctcggagagaaggaggtgatcaaagggtgaagtcggtgata
aaccttctgtttgccgcatacactggagatgtgtctgccctccgaaggtttgctctgtca
gccatggacatggagcagcgggattatgactccagaacagccctccatgtcgcagcagca
gagggtcatgttgaagttgtcaagtttttgctggaagcttgcaaagtaaaccctttcccc
aaggacaggtggaataatacccccatggatgaagcactacactttggacaccatgatgtt
tttaaaatccttcaggaataccaagttcagtacacacctcaaggggattctgatgatgga
aagggaaaccagactgtccacaagaatctcgacgggttgctataa

KEGG   Mus musculus (mouse): 216456Help
Entry
216456            CDS       T01002                                 

Gene name
Gls2, A330074B06Rik, AI195532, GA, GLS, Lga
Definition
(RefSeq) glutaminase 2 (liver, mitochondrial)
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00471  D-Glutamine and D-glutamate metabolism
mmu01100  Metabolic pathways
mmu04724  Glutamatergic synapse
mmu04727  GABAergic synapse
mmu04964  Proximal tubule bicarbonate reclamation
mmu05206  MicroRNAs in cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    216456 (Gls2)
   00220 Arginine biosynthesis
    216456 (Gls2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    216456 (Gls2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    216456 (Gls2)
  09156 Nervous system
   04724 Glutamatergic synapse
    216456 (Gls2)
   04727 GABAergic synapse
    216456 (Gls2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    216456 (Gls2)
   05230 Central carbon metabolism in cancer
    216456 (Gls2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     216456 (Gls2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 216456
NCBI-ProteinID: NP_001028436
MGI: 2143539
Ensembl: ENSMUSG00000044005
Vega: OTTMUSG00000033507
UniProt: Q571F8
LinkDB All DBs
Position
10; 10 D3
AA seq 602 aa AA seqDB search
MRSMRALQNALSRAGSHGRRGGWGHPSRGPLLGRGVRYYLGEAAAQGRGTPHSHQPQHSD
HDASHSGMLPRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQ
ESSSGGLLDRELFQKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKEPTGGKVA
AYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYHDSYLLSETQAEAAAETLSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatgagggctctgcagaacgcgctgagccgcgcgggcagccacggtcggcgg
ggaggctggggtcatccgagccggggcccgcttctgggcaggggcgtccggtactacctc
ggtgaggccgcagcgcagggcagggggacgccgcacagccaccagccgcagcactcggat
catgacgcctcacacagcggcatgctgcctcgacttggtgacctgcttttctacactatt
gcagagggacaggagcgtatccctatccacaagttcaccacggctctgaaggccactgga
ctgcagacgtcagacccacggctccaggactgcatgagcaagatgcagcgcatggtccaa
gagtccagcagcggtggcctcttggaccgagagctcttccaaaagtgtgtgagcagcaac
attgtgctcctgactcaggcattccgaaagaagtttgtcattcctgactttgaggagttc
acgggccatgtggatcgcatatttgaggatgccaaagagcccactggaggcaaagtggca
gcctacatcccgcacctggccaaatcaaacccagacctttggggcgtctccctgtgcact
gtggatgggcagcggcactctgtgggccacacgaagatccccttctgcctgcagtcctgt
gtcaagcccctcacttacgccatctccgtgagcaccttaggcactgactacgtgcacaag
tttgtgggcaaggaacccagtggtctgcgctataacaaactctccctcaatgaggaagga
attccccataaccccatggtcaatgctggtgccattgtggtcagctccctgatcaagatg
gactgtaacaaagcagagaagttcgattttgtgttacagtatctgaacaagatggctggg
aacgaattcatggggttcagcaatgccacattccagtcagagaaggagactggggatcgg
aattacgccatcggctattacctcaaggagaagaagtgcttccctaagggtgtggacatg
atggctgcccttgatctctatttccagctgtgctctgtggaggttacctgtgagtcaggc
agtgtcatggcggccactctggccaatggcggcatctgccctatcacaggggagagcgtg
ctgagcgccgaggccgtgcgcaacaccctcagcctcatgcattcctgtggcatgtatgac
ttctcgggccagtttgccttccatgtgggcctgccagccaagtcagctgtgtcaggagcc
atcctcctggttgtacccaatgtcatgggcatgatgtgtctgtcgccgccgttagacaag
ctggggaacagccaaaggggcatcaacttctgccagaagttggtgtctctctttaacttc
cacaactatgacaacctgcggcactgcgctcggaagttagacccacggagggaaggagga
gaggttcggaacaagaccgtggtgaacctgctatttgctgcatatagtggagatgtctcg
gcccttcgaaggtttgcattgtcggccatggatatggagcagaaggactatgattcccgc
acagccctacatgtcgctgcagctgaagggcacattgaagttgtcaaatttctgatcgag
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacattcccctggacgatgct
gtgcagttcaaccacctggaggtggtcaaactgcttcaagattaccatgactcctacttg
ctctctgagactcaagctgaggcggcagctgagaccctgtccaaagagaatctagagagc
atggtatga

DBGET integrated database retrieval system