KEGG   Mus musculus (mouse): 14672Help
Entry
14672             CDS       T01002                                 

Gene name
Gna11, Dsk7, E430025L19, g_alpha-11
Definition
(RefSeq) guanine nucleotide binding protein, alpha 11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04540  Gap junction
mmu04725  Cholinergic synapse
mmu04730  Long-term depression
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05142  Chagas disease (American trypanosomiasis)
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    14672 (Gna11)
   04022 cGMP-PKG signaling pathway
    14672 (Gna11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14672 (Gna11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    14672 (Gna11)
   04912 GnRH signaling pathway
    14672 (Gna11)
   04928 Parathyroid hormone synthesis, secretion and action
    14672 (Gna11)
   04925 Aldosterone synthesis and secretion
    14672 (Gna11)
   04927 Cortisol synthesis and secretion
    14672 (Gna11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    14672 (Gna11)
  09156 Nervous system
   04725 Cholinergic synapse
    14672 (Gna11)
   04730 Long-term depression
    14672 (Gna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14672 (Gna11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14672 (Gna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14672 (Gna11)
   05163 Human cytomegalovirus infection
    14672 (Gna11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14672 (Gna11)
   05142 Chagas disease (American trypanosomiasis)
    14672 (Gna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14672 (Gna11)
   04031 GTP-binding proteins [BR:mmu04031]
    14672 (Gna11)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14672 (Gna11)
  Exosomal proteins of melanoma cells
   14672 (Gna11)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    14672 (Gna11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 14672
NCBI-ProteinID: NP_034431
MGI: 95766
Ensembl: ENSMUSG00000034781
Vega: OTTMUSG00000030287
UniProt: P21278 Q3UPA1
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 359 aa AA seqDB search
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMVRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgacgaggtgaaggagtcgaagcgc
atcaacgcggagatcgagaaacagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctacttggcactggcgagagcgggaagagtaccttcatcaagcagatgcgc
atcatccacggggccggctactcggaggaggacaagcgcggcttcaccaagttggtgtac
cagaacatctttaccgccatgcaggccatggtgcgcgccatggagacgctcaagatcctc
tacaagtatgagcagaacaaggccaatgcactcctgatccgggaggtcgatgtggagaag
gtcacaacttttgagcaccagtatgtgaatgccatcaagacgctgtggagtgaccctggt
gtccaggagtgttacgatcgcaggcgggagttccagctatctgactcggctaagtactac
ttgacggacgtggaccgcatcgccacagtaggctacctgcccacccagcaggatgtgctg
cgggtacgcgtgcccaccactggcatcatcgagtacccgtttgacctggagaacatcatc
ttcaggatggtggatgtgggcgggcagaggtcagagcgcaggaagtggatccattgcttt
gagaacgtgacttccatcatgttcttggtggcactaagcgagtatgaccaagtcctggtg
gagtcagacaatgagaaccgcatggaggagagcaaggccctgttccgcacaatcatcacc
tacccctggttccagaactcgtctgtcattctcttcctcaacaagaaggaccttctagaa
gacaagatcctgcactcacacttggtcgattacttccctgagtttgatgggccacagagg
gatgcacaggccgcacgcgagttcattctgaagatgtttgtggacctgaaccctgacagc
gacaaaatcatctactcccacttcacgtgtgccaccgacaccgagaacatccgctttgtg
ttcgcagctgtgaaggacaccatcctgcagctgaacctgaaggagtacaacctggtgtga

KEGG   Mus musculus (mouse): 14682Help
Entry
14682             CDS       T01002                                 

Gene name
Gnaq, 1110005L02Rik, 6230401I02Rik, AA408290, AW060788, Dsk1, Dsk10, Galphaq, Gq, GqI
Definition
(RefSeq) guanine nucleotide binding protein, alpha q polypeptide
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14682 (Gnaq)
   04371 Apelin signaling pathway
    14682 (Gnaq)
   04020 Calcium signaling pathway
    14682 (Gnaq)
   04071 Sphingolipid signaling pathway
    14682 (Gnaq)
   04022 cGMP-PKG signaling pathway
    14682 (Gnaq)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14682 (Gnaq)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14682 (Gnaq)
  09152 Endocrine system
   04911 Insulin secretion
    14682 (Gnaq)
   04922 Glucagon signaling pathway
    14682 (Gnaq)
   04912 GnRH signaling pathway
    14682 (Gnaq)
   04915 Estrogen signaling pathway
    14682 (Gnaq)
   04921 Oxytocin signaling pathway
    14682 (Gnaq)
   04918 Thyroid hormone synthesis
    14682 (Gnaq)
   04928 Parathyroid hormone synthesis, secretion and action
    14682 (Gnaq)
   04916 Melanogenesis
    14682 (Gnaq)
   04924 Renin secretion
    14682 (Gnaq)
   04925 Aldosterone synthesis and secretion
    14682 (Gnaq)
   04927 Cortisol synthesis and secretion
    14682 (Gnaq)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    14682 (Gnaq)
   04270 Vascular smooth muscle contraction
    14682 (Gnaq)
  09154 Digestive system
   04970 Salivary secretion
    14682 (Gnaq)
   04971 Gastric acid secretion
    14682 (Gnaq)
   04972 Pancreatic secretion
    14682 (Gnaq)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    14682 (Gnaq)
  09156 Nervous system
   04724 Glutamatergic synapse
    14682 (Gnaq)
   04725 Cholinergic synapse
    14682 (Gnaq)
   04728 Dopaminergic synapse
    14682 (Gnaq)
   04726 Serotonergic synapse
    14682 (Gnaq)
   04720 Long-term potentiation
    14682 (Gnaq)
   04730 Long-term depression
    14682 (Gnaq)
   04723 Retrograde endocannabinoid signaling
    14682 (Gnaq)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    14682 (Gnaq)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14682 (Gnaq)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14682 (Gnaq)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14682 (Gnaq)
   05016 Huntington disease
    14682 (Gnaq)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14682 (Gnaq)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14682 (Gnaq)
   05163 Human cytomegalovirus infection
    14682 (Gnaq)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14682 (Gnaq)
   05142 Chagas disease (American trypanosomiasis)
    14682 (Gnaq)
   05143 African trypanosomiasis
    14682 (Gnaq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14682 (Gnaq)
   04031 GTP-binding proteins [BR:mmu04031]
    14682 (Gnaq)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14682 (Gnaq)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    14682 (Gnaq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 14682
NCBI-ProteinID: NP_032165
MGI: 95776
Ensembl: ENSMUSG00000024639
Vega: OTTMUSG00000036872
UniProt: P21279 Q3UHH5
LinkDB All DBs
Structure
PDB: 

Position
19 A; 19 11.01 cM
AA seq 359 aa AA seqDB search
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggagg
atcaacgacgagatcgagcggcagctgcgcagggacaagcgcgacgcccgccgggagctc
aagctgctgctgctggggacaggggagagtggcaagagcaccttcatcaagcagatgagg
atcatccacgggtcgggctactctgacgaagacaagcgcggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagcgatggacacgctcaagatccca
tacaagtatgaacacaataaggctcatgcacaattggttcgagaggttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagcttgtggaatgatcctgga
atccaggagtgctacgacagacgacgggaatatcagttatctgactctaccaaatactat
ctgaatgacttggaccgtgtagccgacccttcctatctgcctacacaacaagacgtgctt
agagttcgagtccccactacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctccatcatgtttctagtagcgcttagcgaatatgatcaagttcttgtg
gagtcagacaatgagaaccgcatggaggagagcaaagcactctttagaacaattatcacc
tacccctggttccagaactcctctgtgattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccacctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagctcgagaattcatcctgaaaatgttcgtggacctgaaccccgacagt
gacaaaatcatctactcccacttcacgtgcgccacagataccgagaacatccgcttcgtc
tttgcagccgtcaaggacaccatcctgcagctgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system