KEGG   Mus musculus (mouse): 14677Help
Entry
14677             CDS       T01002                                 

Gene name
Gnai1, AU046200, Gialpha1, Gnai-1
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting 1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04360  Axon guidance
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05133  Pertussis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14677 (Gnai1)
   04371 Apelin signaling pathway
    14677 (Gnai1)
   04071 Sphingolipid signaling pathway
    14677 (Gnai1)
   04024 cAMP signaling pathway
    14677 (Gnai1)
   04022 cGMP-PKG signaling pathway
    14677 (Gnai1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14677 (Gnai1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14677 (Gnai1)
   04670 Leukocyte transendothelial migration
    14677 (Gnai1)
   04062 Chemokine signaling pathway
    14677 (Gnai1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    14677 (Gnai1)
   04915 Estrogen signaling pathway
    14677 (Gnai1)
   04914 Progesterone-mediated oocyte maturation
    14677 (Gnai1)
   04921 Oxytocin signaling pathway
    14677 (Gnai1)
   04926 Relaxin signaling pathway
    14677 (Gnai1)
   04935 Growth hormone synthesis, secretion and action
    14677 (Gnai1)
   04928 Parathyroid hormone synthesis, secretion and action
    14677 (Gnai1)
   04916 Melanogenesis
    14677 (Gnai1)
   04924 Renin secretion
    14677 (Gnai1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    14677 (Gnai1)
  09154 Digestive system
   04971 Gastric acid secretion
    14677 (Gnai1)
  09156 Nervous system
   04724 Glutamatergic synapse
    14677 (Gnai1)
   04727 GABAergic synapse
    14677 (Gnai1)
   04725 Cholinergic synapse
    14677 (Gnai1)
   04728 Dopaminergic synapse
    14677 (Gnai1)
   04726 Serotonergic synapse
    14677 (Gnai1)
   04730 Long-term depression
    14677 (Gnai1)
   04723 Retrograde endocannabinoid signaling
    14677 (Gnai1)
  09158 Development and regeneration
   04360 Axon guidance
    14677 (Gnai1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14677 (Gnai1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14677 (Gnai1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    14677 (Gnai1)
  09165 Substance dependence
   05030 Cocaine addiction
    14677 (Gnai1)
   05032 Morphine addiction
    14677 (Gnai1)
   05034 Alcoholism
    14677 (Gnai1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14677 (Gnai1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    14677 (Gnai1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14677 (Gnai1)
   05163 Human cytomegalovirus infection
    14677 (Gnai1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14677 (Gnai1)
   05142 Chagas disease (American trypanosomiasis)
    14677 (Gnai1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14677 (Gnai1)
   04031 GTP-binding proteins [BR:mmu04031]
    14677 (Gnai1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14677 (Gnai1)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    14677 (Gnai1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 14677
NCBI-ProteinID: NP_034435
MGI: 95771
Ensembl: ENSMUSG00000057614
Vega: OTTMUSG00000053058
UniProt: B2RSH2
LinkDB All DBs
Position
5 A3; 5 8.16 cM
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacattgagcgctgaggacaaggcggccgtggagcgcagcaagatgatcgac
cgcaacctccgggaggacggcgagaaggcggcgcgggaggtcaagctgctgctgctgggt
gctggggaatctggaaagagtaccattgtgaagcagatgaagattatccacgaagccggc
tactcggaagaggagtgtaagcagtacaaggcagtggtctacagcaacactatccagtcc
atcattgccatcattagagccatggggaggttgaaaatcgacttcggagactctgctcgg
gcggatgatgctcgccaacttttcgtgcttgctggggctgcagaagaaggctttatgact
gcagagctcgccggtgtcataaagagactgtggaaagacagtggtgtgcaagcctgcttc
aacagatcccgggagtaccagctgaacgattcggcagcgtactatctgaatgacttggac
agaatagcacagccaaattacatcccaactcagcaggatgtcctcagaaccagagtgaag
accacagggattgtggaaacccactttaccttcaaagatcttcattttaaaatgtttgac
gtgggaggtcagaggtcagagcggaagaagtggatccactgctttgaaggggtgaccgcc
atcatcttctgtgtggccctgagtgactatgacctggttcttgctgaagatgaagaaatg
aaccgtatgcacgagagcatgaagctgttcgatagcatctgtaacaacaagtggtttaca
gacacgtccatcatccttttcctcaacaagaaggacctcttcgaagaaaaaataaaaaag
agccccctcacgatatgctacccagaatatgcaggctcaaacacatatgaagaagcggcc
gcgtatattcagtgtcagtttgaagacctcaataaaaggaaggacacaaaggaaatttac
acccacttcacgtgcgccacagatacgaagaacgtgcagttcgtgttcgatgctgtaaca
gacgtcatcataaagaataacctaaaagactgtggtctcttctaa

KEGG   Mus musculus (mouse): 14678Help
Entry
14678             CDS       T01002                                 

Gene name
Gnai2, C76432, Galphai2, Gia, Gnai-2
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting 2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04360  Axon guidance
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05133  Pertussis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14678 (Gnai2)
   04371 Apelin signaling pathway
    14678 (Gnai2)
   04071 Sphingolipid signaling pathway
    14678 (Gnai2)
   04024 cAMP signaling pathway
    14678 (Gnai2)
   04022 cGMP-PKG signaling pathway
    14678 (Gnai2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14678 (Gnai2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14678 (Gnai2)
   04670 Leukocyte transendothelial migration
    14678 (Gnai2)
   04062 Chemokine signaling pathway
    14678 (Gnai2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    14678 (Gnai2)
   04915 Estrogen signaling pathway
    14678 (Gnai2)
   04914 Progesterone-mediated oocyte maturation
    14678 (Gnai2)
   04921 Oxytocin signaling pathway
    14678 (Gnai2)
   04926 Relaxin signaling pathway
    14678 (Gnai2)
   04935 Growth hormone synthesis, secretion and action
    14678 (Gnai2)
   04928 Parathyroid hormone synthesis, secretion and action
    14678 (Gnai2)
   04916 Melanogenesis
    14678 (Gnai2)
   04924 Renin secretion
    14678 (Gnai2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    14678 (Gnai2)
  09154 Digestive system
   04971 Gastric acid secretion
    14678 (Gnai2)
  09156 Nervous system
   04724 Glutamatergic synapse
    14678 (Gnai2)
   04727 GABAergic synapse
    14678 (Gnai2)
   04725 Cholinergic synapse
    14678 (Gnai2)
   04728 Dopaminergic synapse
    14678 (Gnai2)
   04726 Serotonergic synapse
    14678 (Gnai2)
   04730 Long-term depression
    14678 (Gnai2)
   04723 Retrograde endocannabinoid signaling
    14678 (Gnai2)
  09158 Development and regeneration
   04360 Axon guidance
    14678 (Gnai2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14678 (Gnai2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14678 (Gnai2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    14678 (Gnai2)
  09165 Substance dependence
   05030 Cocaine addiction
    14678 (Gnai2)
   05032 Morphine addiction
    14678 (Gnai2)
   05034 Alcoholism
    14678 (Gnai2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14678 (Gnai2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    14678 (Gnai2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14678 (Gnai2)
   05163 Human cytomegalovirus infection
    14678 (Gnai2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14678 (Gnai2)
   05142 Chagas disease (American trypanosomiasis)
    14678 (Gnai2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14678 (Gnai2)
   04031 GTP-binding proteins [BR:mmu04031]
    14678 (Gnai2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14678 (Gnai2)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    14678 (Gnai2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 14678
NCBI-ProteinID: NP_032164
MGI: 95772
Ensembl: ENSMUSG00000032562
Vega: OTTMUSG00000050782
UniProt: P08752
LinkDB All DBs
Position
9 F1; 9 58.43 cM
AA seq 355 aa AA seqDB search
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGML
PEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcagccgagcgctctaaaatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgcttctgttaggt
gctggagagtcagggaagagcaccatcgtcaagcagatgaagatcatccatgaagatggc
tactcagaagaggagtgccggcagtaccgtgccgtggtctacagcaacaccatccagtct
atcatggccatcgtgaaggccatgggcaacctgcagatcgactttgctgatccccagcgt
gcggatgatgccaggcagctgttcgccctgtcctgtgctgcagaggaacaagggatgctt
cctgaagacctgtccggtgtcatccggaggctctgggctgaccacggtgtgcaagcctgc
tttggccgctcacgagaataccagctcaatgactcagccgcttactacctgaatgatctg
gagcgcattgcacagagtgactacatccctacacagcaggatgtgctgcggacccgtgtg
aagaccacgggcatcgtggaaacacacttcaccttcaaggacttacacttcaagatgttt
gatgtgggtggtcagcggtctgagcgcaagaagtggatccactgctttgagggcgtcacg
gccatcatcttctgtgtcgccttgagcgcttatgacttggtgctggctgaggatgaggag
atgaaccgcatgcatgagagcatgaagctgtttgacagcatctgcaacaacaagtggttc
acagacacctccatcatcctcttcctcaacaagaaggacctgtttgaagaaaagatcaca
cagagctccctgaccatctgtttccctgagtacacgggggccaacaagtacgacgaggca
gccagctacatccagagcaagtttgaggatctaaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagtttgtgttcgatgccgtc
actgacgtcatcatcaagaacaacctgaaggactgtggcctcttctga

KEGG   Mus musculus (mouse): 14679Help
Entry
14679             CDS       T01002                                 

Gene name
Gnai3, AI158965, AW537698, Galphai3, Gnai-3
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting 3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04360  Axon guidance
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04914  Progesterone-mediated oocyte maturation
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04924  Renin secretion
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04971  Gastric acid secretion
mmu05012  Parkinson disease
mmu05030  Cocaine addiction
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05133  Pertussis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14679 (Gnai3)
   04371 Apelin signaling pathway
    14679 (Gnai3)
   04071 Sphingolipid signaling pathway
    14679 (Gnai3)
   04024 cAMP signaling pathway
    14679 (Gnai3)
   04022 cGMP-PKG signaling pathway
    14679 (Gnai3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14679 (Gnai3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14679 (Gnai3)
   04670 Leukocyte transendothelial migration
    14679 (Gnai3)
   04062 Chemokine signaling pathway
    14679 (Gnai3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    14679 (Gnai3)
   04915 Estrogen signaling pathway
    14679 (Gnai3)
   04914 Progesterone-mediated oocyte maturation
    14679 (Gnai3)
   04921 Oxytocin signaling pathway
    14679 (Gnai3)
   04926 Relaxin signaling pathway
    14679 (Gnai3)
   04935 Growth hormone synthesis, secretion and action
    14679 (Gnai3)
   04928 Parathyroid hormone synthesis, secretion and action
    14679 (Gnai3)
   04916 Melanogenesis
    14679 (Gnai3)
   04924 Renin secretion
    14679 (Gnai3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    14679 (Gnai3)
  09154 Digestive system
   04971 Gastric acid secretion
    14679 (Gnai3)
  09156 Nervous system
   04724 Glutamatergic synapse
    14679 (Gnai3)
   04727 GABAergic synapse
    14679 (Gnai3)
   04725 Cholinergic synapse
    14679 (Gnai3)
   04728 Dopaminergic synapse
    14679 (Gnai3)
   04726 Serotonergic synapse
    14679 (Gnai3)
   04730 Long-term depression
    14679 (Gnai3)
   04723 Retrograde endocannabinoid signaling
    14679 (Gnai3)
  09158 Development and regeneration
   04360 Axon guidance
    14679 (Gnai3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14679 (Gnai3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14679 (Gnai3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    14679 (Gnai3)
  09165 Substance dependence
   05030 Cocaine addiction
    14679 (Gnai3)
   05032 Morphine addiction
    14679 (Gnai3)
   05034 Alcoholism
    14679 (Gnai3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14679 (Gnai3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    14679 (Gnai3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14679 (Gnai3)
   05163 Human cytomegalovirus infection
    14679 (Gnai3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14679 (Gnai3)
   05142 Chagas disease (American trypanosomiasis)
    14679 (Gnai3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14679 (Gnai3)
   04031 GTP-binding proteins [BR:mmu04031]
    14679 (Gnai3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14679 (Gnai3)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    14679 (Gnai3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 14679
NCBI-ProteinID: NP_034436
MGI: 95773
Ensembl: ENSMUSG00000000001
Vega: OTTMUSG00000007197
UniProt: Q9DC51
LinkDB All DBs
Position
3 F2.3; 3 46.83 cM
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVLAGSAEEGVMT
SELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggggagaaagcggccaaagaagtgaagctgctgctgctcggc
gctggagaatctggtaaaagtaccatcgtgaaacagatgaaaatcattcatgaggacggc
tattcagaggacgaatgtaaacagtataaagtagttgtctacagcaatactattcagtcc
atcattgcaatcatacgagccatgggacggttgaagattgattttggggaatctgccaga
gcagatgatgcccgacagttatttgttttagctgggagtgctgaagaaggagtcatgact
tcagaactagcaggcgtgattaaacgtttatggcgagatggcggggtacaggcatgcttt
agcaggtccagggaatatcagctcaatgattctgcttcatactacctaaatgatttggat
agaatatcccagaccaactacattccaactcagcaagatgttcttcggacaagagtgaag
actacaggcattgtggagacccacttcaccttcaaggaactctacttcaaaatgtttgat
gtaggtggccaaagatccgaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttttgtgtggctctcagtgattacgaccttgttctggctgaggatgaggaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctctttcttaataagaaagacctttttgaggaaaaaataaagagg
agtccattaacaatctgttatccagaatacacaggttccaatacatacgaagaggcagct
gcttacattcagtgccagtttgaagatctgaaccgaagaaaagataccaaggaggtctac
actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgttacg
gatgtcatcattaaaaacaacttaaaggaatgtgggctttattga

DBGET integrated database retrieval system