KEGG   Mus musculus (mouse): 14772Help
Entry
14772             CDS       T01002                                 

Gene name
Grk4, A830025H08Rik, GRK, Gprk2l, Gprk4
Definition
(RefSeq) G protein-coupled receptor kinase 4
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14772 (Grk4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14772 (Grk4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14772 (Grk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     14772 (Grk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   14772 (Grk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 14772
NCBI-ProteinID: NP_062370
MGI: 95801
Ensembl: ENSMUSG00000052783
Vega: OTTMUSG00000023169
UniProt: O70291
LinkDB All DBs
Position
5 B2; 5 17.91 cM
AA seq 574 aa AA seqDB search
MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELRWSIEKDFSSLCDKQP
IGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAIFSRFFKEKSEVPLPEI
PPDIVKECKWNLKQNSPSQNVFEECAGIVCKYLSETPFEEYQESTYFNRFLQWKWLERRP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRILEK
LHSRFVVSLAYTYETKDALCLVLTIMNGGDLKYHIYNLGDPGFEEPRAVFYAAELCCGLE
DLQRKRIVYRDLKPENILLDDHGHIRISDLGLAMEVPEGEMVRGRVGTVGYMAPEIINHE
KYTFSPDWWGLGCLIYEMIAGHSPFRKYKEKVNREELERRVKNETEEYSERFSEDAKSIC
SMLLIKDPSKRLGCQRDGVSAVKQHPIFKDINFSRLEANMLDPPFIPDPQAIYCRNILDI
GQFSVVKGVNLDTNDEIFYAEFATGSVTIPWQNEMIESGCFKDLNENEDDLSSLEKYKMC
SSILRPKRNFFRRLFRRTGCLNIALSEEREPTEH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgagaacttcgtggccaacaatctgttgctgaaggcccgtctaggatttaac
aaacagactggtcgtagtaaaaaatggagagagctcctgaagtttcccccagtcagcatg
tgcactgaattaagatggtccatcgaaaaggattttagcagtctttgcgacaaacagcca
attggaagacttctttttagacaattctgtgatacaaaaccagatctaaaaaggtgcatt
gaattcttggatgcagtggcagagtacgaagttaccattgaagaggaacaaagagaattt
ggactagccatcttcagtagattcttcaaagagaagtcagaagtccccttaccagagata
cctccagatattgtgaaagagtgtaaatggaatctgaagcagaattctccctctcaaaat
gttttcgaagaatgtgctggaattgtctgtaagtatttgagtgaaacaccatttgaagaa
taccaagaaagtacctactttaatcgatttttacaatggaaatggctagaaaggcgtcca
gtaacaaagaacacattcagacaatatagagttctaggaaaaggcggatttggagaggtt
tgtgcctgtcaagtacgagctacaggaaaaatgtatgcctgcaaaaaactagaaaaaaaa
agaataaagaagaggaaaggtgaagccatggctctgaatgaaaaaagaatcttagaaaaa
ttgcatagtagatttgtagttagtttagcctacacttatgaaaccaaggatgctttgtgt
ttggtgctaaccataatgaatggaggggatttgaagtaccacatttacaacctgggtgat
cctggctttgaggagccgagagctgtgttctatgctgcagagctgtgctgtggcttggaa
gatttacagaggaaaagaattgtatacagagacctaaagccagagaatatcctccttgat
gatcatggacacatccgaatttcagatcttggtctagctatggaagtcccagaaggggag
atggtacgaggaagagttggtactgttggctacatggctccagaaattatcaatcatgaa
aagtatacatttagtcctgactggtggggacttggctgtttgatatatgaaatgattgcg
ggacattctccattcagaaaatataaagaaaaagtcaaccgggaggaattggaaagaaga
gtgaagaatgaaactgaggagtactctgagaggttttcagaggatgccaagtccatctgc
agcatgttactcatcaaagatccaagtaagagactgggctgccagagggatggagtctct
gctgtaaagcagcacccaatattcaaggatataaacttcagcaggctggaagcaaatatg
ttagatccacctttcattcctgatcctcaggccatttattgtaggaacatcttggatatt
gggcagttctctgtggtgaaaggagtcaacctggataccaatgatgaaatcttctacgct
gaatttgcgacagggtctgtcaccatcccctggcagaatgagatgattgaatctggatgt
ttcaaggatctcaatgaaaatgaagacgatttgtcatcacttgaaaaatacaagatgtgt
tcctccattctcagaccaaagagaaacttcttccgtagactcttcagaagaacgggctgc
ctgaacattgccctcagtgaggagagggagccaacagaacactga

DBGET integrated database retrieval system