KEGG   Mus musculus (mouse): 14815
Entry
14815             CDS       T01002                                 

Gene name
Nr3c1, G, GR, Grl, Grl-1, Grl1
Definition
(RefSeq) nuclear receptor subfamily 3, group C, member 1
  KO
K05771  glucocorticoid receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14815 (Nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14815 (Nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    14815 (Nr3c1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    14815 (Nr3c1)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   14815 (Nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 Med3 TFIIA
Other DBs
NCBI-GeneID: 14815
NCBI-ProteinID: NP_001348138
MGI: 95824
Ensembl: ENSMUSG00000024431
Vega: OTTMUSG00000023975
LinkDB
Structure
PDB: 
3MNP 3MNO 3MNE

Position
18 B3; 18 21.09 cM
AA seq 792 aa
MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSASSPSVAAASQADSKQQ
RILLDFSKGSASNAQQQQQQQQQQQQQQQQQPQPDLSKAVSLSMGLYMGETETKVMGNDL
GYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEKEFPQTHSD
PSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPWRSDLLIDEN
LLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVALPQVKTEKDDF
IELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQ
QQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSNGYSSPGMRPDVS
SPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQDTSENANKTIVPAAL
PQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQVIAAVKWAKAIPGFR
NLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLIINEQRMTLPCMYDQCKH
MLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKRE
GNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSIEFPEMLAEIITNQIPKYS
NGNIKKLLFHQK
NT seq 2379 nt   +upstreamnt  +downstreamnt
atggactccaaagaatccttagctccccctggtagagacgaagtccccagcagtttgctt
ggccgggggaggggaagcgtgatggacttgtataaaaccctgaggggtggagctacagtc
aaggtttctgcgtcttcaccctcagtggctgctgcttctcaggcagattccaagcagcag
aggattctccttgatttttcaaaaggctcagcaagcaatgcgcagcagcagcagcagcag
cagcagcagcagcagcagcagcagcagcagcagccgcagccagatttatccaaagccgtt
tcactgtccatgggactgtatatgggagagaccgaaacaaaagtgatggggaatgacttg
ggctacccacagcagggccagcttggcctctcctctggggaaacagactttcggcttctg
gaagaaagcattgcaaacctcaataggtcgaccagccgtccagagaaccccaagagttca
acacctgcagctgggtgtgctaccccgacagagaaggagtttccccagactcactctgat
ccatcttcagaacagcaaaatagaaaaagccagcctggcaccaacggtggcagtgtgaaa
ttgtataccacagaccaaagcacctttgacatcttgcaggatttggagttttctgccggg
tccccaggtaaagagacaaacgagagtccttggaggtcagacctgttgatagatgaaaac
ttgctttctcctttggcgggagaagatgatccattccttctggaaggggacgtgaatgag
gattgcaagcctcttattttaccggacactaaacctaaaattcaggatactggagataca
atcttatcaagccccagcagtgtggcactgccccaagtgaaaacagagaaagatgatttc
attgagctttgcacccctggggtaattaagcaagagaaactgggcccggtttattgccag
gcaagcttttctgggacaaatataattgggaataaaatgtctgccatttctgttcatggc
gtgagtacctctggaggacagatgtaccactatgacatgaatacagcatccctttctcag
cagcaggatcagaagcctgtttttaatgtcattccaccaattcctgttggttctgaaaac
tggaataggtgccaagggtctggagaggacaacctgacttccttgggggctatgaacttc
gcaggccgctcagtgttttctaatggatattcaagccctggaatgagaccagatgtgagt
tctcctccgtccagctcctccacagcaacgggaccacctcccaaactctgcctggtgtgc
tccgatgaagcttcgggatgccattatggggtgctgacgtgtggaagctgtaaagtcttc
tttaaaagagcagtggaaggacagcacaattacctttgtgctggaagaaatgattgcatc
attgataaaattcgaagaaaaaactgtccagcatgccgctatcgaaaatgtcttcaagct
ggaatgaacctggaagctcgaaaaacgaagaaaaaaattaaaggaattcagcaagccact
gcaggagtctcacaagacacttctgaaaacgctaacaaaacaatagttcctgccgcgctg
ccacagcttacccctaccctggtgtcactgctggaggtgatcgagcctgaggtgttatat
gcaggatatgacagctctgttccagactcagcatggagaattatgaccacgctcaacatg
ttaggtgggcgccaagtgattgccgcagtgaaatgggcaaaggcgataccaggattcaga
aacttacacctggatgaccaaatgacccttctacagtactcatggatgtttctcatggca
tttgccctgggttggagatcatacagacaagcaagtggaaacctgctatgctttgctcct
gatctgattattaatgagcagagaatgactctaccctgcatgtatgaccaatgtaaacac
atgctgtttatctccactgaattacaaagattgcaggtatcctatgaagagtatctctgt
atgaaaaccttactgcttctctcctcagttcctaaggaaggtctgaagagccaagagtta
tttgatgagattcgaatgacttatatcaaagagctaggaaaagccattgtcaaaagggaa
ggaaactccagtcagaattggcagcggttttatcaactgacaaaacttttggactccatg
catgatgtggttgaaaatctccttagctactgcttccaaacatttttggataagtccatg
agtattgaattcccagagatgttagctgaaatcatcactaatcagataccaaaatactca
aatggaaatatcaaaaagcttctgtttcatcagaaatga

DBGET integrated database retrieval system