KEGG   Mus musculus (mouse): 14874Help
Entry
14874             CDS       T01002                                 

Gene name
Gstz1, GSTZ1-1, MAAI
Definition
(RefSeq) glutathione transferase zeta 1 (maleylacetoacetate isomerase)
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00350  Tyrosine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    14874 (Gstz1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     14874 (Gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_3 GST_C GST_C_2 GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 14874
NCBI-ProteinID: NP_034493
MGI: 1341859
Ensembl: ENSMUSG00000021033
UniProt: Q9WVL0
LinkDB All DBs
Structure
PDB: 

Position
12; 12 D2
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVP
ALKIDGITIVQSLAIMEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQNLSVLK
QVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDL
SPYPTISHINKELLALEVFQVSHPRRQPDTPAELRT
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccgggaagcctatcctctactcctatttccgaagctcctgttcatggagagtt
cgaattgctctggcgttaaaaggcattgactatgagatagtgcccatcaacctcataaag
gatggcgggcaacagttcactgaggaatttcagaccctgaaccccatgaagcaagtgcca
gcgctgaaaattgatggaatcaccattgtccagtcactggccatcatggagtacctggaa
gagactcggcctatcccacggctcctgcctcaggacccacagaaaagagccatcgtgcgc
atgatttctgacctcatcgctagtggcatccagccccttcagaacctgtctgtcctgaag
caagtgggacaggagaaccagatgcaatgggcccaaaaggttattacttccggctttaac
gctctggagaagattctgcagagcacagcagggaagtactgcgtaggagatgaggtatcc
atggctgatgtgtgcttagtaccccaagtggcaaatgctgaaaggttcaaggtggatcta
agcccctaccctaccatcagtcacatcaacaaggagctgctagccttagaggttttccaa
gtgtctcacccccgtcgacagccagatacccctgccgagctgaggacttag

DBGET integrated database retrieval system