KEGG   Mus musculus (mouse): 14936Help
Entry
14936             CDS       T01002                                 

Gene name
Gys1, Gys3, MGS
Definition
(RefSeq) glycogen synthase 1, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
Module
mmu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    14936 (Gys1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    14936 (Gys1)
   04152 AMPK signaling pathway
    14936 (Gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14936 (Gys1)
   04922 Glucagon signaling pathway
    14936 (Gys1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    14936 (Gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    14936 (Gys1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     14936 (Gys1)
Glycosyltransferases [BR:mmu01003]
 Polysaccharide
  Storage polysaccharide
   14936 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 14936
NCBI-ProteinID: NP_109603
MGI: 101805
Ensembl: ENSMUSG00000003865
Vega: OTTMUSG00000023845
UniProt: Q9Z1E4
LinkDB All DBs
Position
7 B3; 7 29.31 cM
AA seq 738 aa AA seqDB search
MPLSRSLSVSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLGEDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSLGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcagtctctctgtgtcctcgcttccaggattggaagactgggaggat
gaattcgaccccgagaacgcagtgcttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcgaaggtgacaggggatgaatggggtgac
aactactatctggtgggaccatacacggagcagggtgtgaggacgcaggtagagctcctg
gagcccccaactccggaactgaagaggactttggattccatgaacagcaagggttgtaag
gtgtattttgggcgttggctgatcgaggggggacccctagtggtgctcctggatgtagga
gcctcagcttgggccctggagcgctggaagggtgagctttgggacacctgcaacatcggg
gtaccctggtacgaccgcgaggccaatgacgctgtcctgttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaagagaagccgtatgtggttgcccacttccac
gaatggttggctggcgttggtctgtgtctgtgccgtgcccggcgcttgccggtggcaacc
atcttcaccactcatgccacgctgctggggcgctacctgtgtgctggcgctgtggacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggagagaggcagatctatcac
cggtactgcatggagcgtgcagcagctcactgtgcccatgtcttcactaccgtatcccag
atcaccgcaatcgaggctcaacacctccttaagagaaaaccagatattgtgacccccaac
gggctgaatgtgaagaagttctctgctatgcacgaattccagaaccttcatgctcagagc
aaagcacgaatccaggaatttgtgcgtggccatttttatgggcacctggacttcaaccta
gacaagactttgtatttctttatcgctggccgctatgagttttccaacaagggagctgat
gtgttcctggaggcattggcccggctcaactatctgctcagagtgaatggcagtgagcaa
acagttgtcgcattcttcatcatgccggcccggaccaataatttcaacgtggaaaccctg
aagggccaagccgtgcgcaaacaactatgggacacagccaatacagtcaaggagaaattt
gggaggaagctctacgaatcccttttagtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccactcagcggcagtctttc
ccaccagtgtgcacccacaacatgctggacgactcctcagaccccatcttgaccaccatc
cgccgaattggccttttcaacagcagtgccgaccgtgtgaaggtgatttttcacccagaa
ttcctttcttccacaagccctctcctccccgtggattatgaggaatttgtccgcggctgt
caccttggggtcttcccctcctactatgagccctggggctacacaccagcggagtgcact
gtcatgggcatccccagcatctccaccaacctctccggctttggctgctttatggaggaa
cacatcgcagatccctcagcttacggcatttacattctggatcggaggttccgcagcctg
gatgattcatgctcacagctcacctccttcctgtacagcttctgccagcagagccggcga
cagcgcatcatccagcggaaccgcacagaacggttgtcggacttgctagattggaagtac
ctgggccggtactacatgtctgcgcgccacatggctctggccaaggcctttccagaccac
ttcacctatgaaccccatgaggtagatgcgacccaggggtaccggtacccacgaccagcc
tccgtcccgccgtcgccctcactgtctcgacactccagcccacaccagagtgaggatgag
gaagagccacgggatggacccctgggggaagacagtgagcgttatgatgaggaagaggag
gctgccaaggaccgccgcaacatccgggcacctgagtggccacgcagggcctcctgttcc
tcctccacaggtggcagcaagagaagcaactcggtggacactgggccctccagctcactc
agcacacccactgagcccctgagtcctaccagttccctgggtgaggagcgcaactaa

DBGET integrated database retrieval system