KEGG   Mus musculus (mouse): 15110Help
Entry
15110             CDS       T01002                                 

Gene name
Hand1, Ehand1, Hxt, Th1, Thing1, bHLHa27, eHAND
Definition
(RefSeq) heart and neural crest derivatives expressed 1
  KO
K09071  heart-and neural crest derivatives-expressed protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15110 (Hand1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15110 (Hand1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    15110 (Hand1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH HTH_51
Motif
Other DBs
NCBI-GeneID: 15110
NCBI-ProteinID: NP_032239
MGI: 103577
Ensembl: ENSMUSG00000037335
Vega: OTTMUSG00000005713
UniProt: Q64279 Q5SQG1
LinkDB All DBs
Position
11 B1.3; 11 35.27 cM
AA seq 216 aa AA seqDB search
MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRE
LPQQPESFPPASGPGEKRIKGRTGWPQQVWALELNQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgtgggcagctacgcacatcatcaccatcatcaccactcacacccgccgcac
cccatgctccacgaacccttcctgtttggcccggcctcgcgttgccaccaggagcggcct
tacttccagagctggctgctgagcccggctgatgctgccccagatttccctgccggcggg
ccaccacctaccaccgcagtagcagcggctgcctatggtcccgatgccaggccgagtcag
agcccaggtcggctggaggctcttggaagccgcctgcccaaacgaaaaggctcaggaccc
aagaaggagaggagacgcacagagagcattaacagcgcgttcgcggagctgcgtgagtgc
atccccaatgtgcccgccgacaccaagctctccaagatcaagactctgcgcctggctacc
agttacatcgcctacttgatggacgtgctggccaaggatgcacaagcaggtgaccccgag
gccttcaaggctgaactcaaaaagacggatggtggtcgcgaaagcaagcggaaaagggag
ttgcctcagcagcccgaaagcttccctcctgcctcggggcccggcgagaagaggattaaa
gggcgcaccggctggcctcagcaagtctgggcgctggagctaaaccagtga

DBGET integrated database retrieval system