KEGG   Mus musculus (mouse): 15182Help
Entry
15182             CDS       T01002                                 

Gene name
Hdac2, D10Wsu179e, YAF1, Yy1bp, mRPD3
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04213  Longevity regulating pathway - multiple species
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05016  Huntington disease
mmu05034  Alcoholism
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    15182 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    15182 (Hdac2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    15182 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    15182 (Hdac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15182 (Hdac2)
   05202 Transcriptional misregulation in cancer
    15182 (Hdac2)
   05206 MicroRNAs in cancer
    15182 (Hdac2)
   05203 Viral carcinogenesis
    15182 (Hdac2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    15182 (Hdac2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    15182 (Hdac2)
  09165 Substance dependence
   05034 Alcoholism
    15182 (Hdac2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    15182 (Hdac2)
   05165 Human papillomavirus infection
    15182 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15182 (Hdac2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     15182 (Hdac2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     15182 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     15182 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    15182 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    15182 (Hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 15182
NCBI-ProteinID: NP_032255
MGI: 1097691
Ensembl: ENSMUSG00000019777
Vega: OTTMUSG00000020840
UniProt: P70288 A0A0R4J008 Q3TMT1
LinkDB All DBs
Position
10 19.44 cM; 10 B1
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactactatgatggtgatatt
ggcaattattattatggccagggtcatcccatgaagcctcatagaatccggatgactcat
aacttgctgctaaattatggtttataccgaaaaatggaaatatataggcctcataaagcc
actgctgaagaaatgactaaataccacagcgatgagtatatcaagtttctacgatcaata
agaccagataatatgtctgagtacagtaagcagatgcagagatttaacgtcggagaagat
tgtccggtgtttgatggactctttgagttttgtcagctctccacgggtggttcagttgct
ggggctgtgaaattaaaccggcaacaaactgatatggctgtcaattgggctggaggacta
catcatgccaagaagtcagaagcatcagggttctgctatgttaatgatattgtgcttgcc
atcctcgaattacttaagtatcatcagagagtcttatatattgacatagacatccaccat
ggtgatggtgttgaggaagctttttatacaacagatcgcgtgatgaccgtctcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgctggaaaggga
aaatactatgctgtcaattttcccatgagagatggtatagatgatgaatcatatggacaa
atttttaagcctatcatctcaaaagtgatggagatgtaccagcctagcgcggtggtgctg
cagtgtggcgcagactccctgtctggggacaggcttggttgtttcaatctaactgtcaaa
ggtcatgctaaatgtgtagaagtagtgaaaacttttaacttgccattgctgatgctcggt
ggaggaggctacacaatccggaatgttgcccgatgttggacatatgagactgcagttgcc
cttgattgtgaaattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatctacgtatgttaccacatgcacctggtgtt
caaatgcaagctattccagaggatgctgttcatgaagacagtggagatgaggatggagaa
gacccggacaaaagaatttccattcgagcatcagacaaacggatagcttgcgatgaagag
ttttcagattctgaggatgaaggtgaaggaggtcgtaggaatgttgctgatcataagaaa
ggagcaaagaaggctaggattgaagaagacaagaaggagacagaggacaagaagacagat
gttaaggaagaagacaaatccaaggacaatagtggtgagaaaacagaccccaaaggagcc
aagtcagaacaactcagcaacccttga

KEGG   Mus musculus (mouse): 433759Help
Entry
433759            CDS       T01002                                 

Gene name
Hdac1, HD1, Hdac1-ps, MommeD5, RPD3
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04213  Longevity regulating pathway - multiple species
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05016  Huntington disease
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    433759 (Hdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    433759 (Hdac1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    433759 (Hdac1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    433759 (Hdac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    433759 (Hdac1)
   05202 Transcriptional misregulation in cancer
    433759 (Hdac1)
   05206 MicroRNAs in cancer
    433759 (Hdac1)
   05203 Viral carcinogenesis
    433759 (Hdac1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    433759 (Hdac1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    433759 (Hdac1)
  09165 Substance dependence
   05031 Amphetamine addiction
    433759 (Hdac1)
   05034 Alcoholism
    433759 (Hdac1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    433759 (Hdac1)
   05165 Human papillomavirus infection
    433759 (Hdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    433759 (Hdac1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     433759 (Hdac1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     433759 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     433759 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    433759 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    433759 (Hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 433759
NCBI-ProteinID: NP_032254
MGI: 108086
Ensembl: ENSMUSG00000028800
Vega: OTTMUSG00000009661
UniProt: O09106 Q58E49
LinkDB All DBs
Position
4 D2.2; 4 63.26 cM
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aactactattatggacaagggcaccccatgaagcctcaccgaatccgcatgactcacaat
ttgctgctcaactatggtctctaccgaaaaatggagatctaccgtcctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcctgcgttctattcgc
ccagataatatgtctgaatacagcaagcagatgcagagattcaatgttggtgaggactgt
ccggtgtttgatggcttgtttgagttctgtcagttgtccacgggaggctctgtcgcaagt
gctgtgaagcttaataagcagcagacggacatcgctgtgaactgggccgggggcctgcac
catgcaaagaagtctgaagcttctggcttctgttacgtcaatgacatcgtcctggccatc
ctggaactgctaaagtaccaccagagggtgctctatattgacattgatattcaccatggc
gatggcgtggaagaggccttctatactacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggacattggggctggcaaaggcaag
tactatgctgtgaactacccactgcgagacggcattgacgacgaatcctatgaagccatc
tttaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcttacag
tgtggctcagattccctgtctggggaccggttaggttgcttcaatctgaccatcaaagga
cacgccaagtgtgtggagttcgtgaagagtttcaacttgcccatgctgatgctgggagga
ggtggctacaccatccggaatgttgctcgctgctggacttacgaaacagcggtggccctg
gacacagagatccctaatgagctgccctacaacgactactttgaatactttggaccggat
ttcaagcttcacatcagcccttccaacatgaccaaccagaacactaacgagtacctggag
aagatcaagcagcgtctctttgagaacttgaggatgctgccccatgcccctggggtccag
atgcaggccatccctgaggatgccatccccgaagagagtggggatgaagatgaggaggac
cctgacaaacgcatctccatctgctcctctgacaaacgcattgcctgtgaggaagagttc
tcggactcagatgaggagggagaaggtggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagttaaaacagaggatgagaaagagaaagatcctgaagagaaaaaagaagtcaca
gaagaagagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
ttggcctga

DBGET integrated database retrieval system