KEGG   Mus musculus (mouse): 15213Help
Entry
15213             CDS       T01002                                 

Gene name
Hey1, AI316788, AI414254, CHF2, HRT1, Herp2, Hesr1, bHLHb31, hesr-1
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif 1
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15213 (Hey1)
  09162 Cancer: specific types
   05224 Breast cancer
    15213 (Hey1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    15213 (Hey1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15213 (Hey1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    15213 (Hey1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 15213
NCBI-ProteinID: NP_034553
MGI: 1341800
Ensembl: ENSMUSG00000040289
Vega: OTTMUSG00000051396
UniProt: Q9QUM5
LinkDB All DBs
Position
3 A1; 3 2.15 cM
AA seq 299 aa AA seqDB search
MKRAHPDYSSSDSELDETIEVEKESADENGNLSSALCSMSPTTSSQVLARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHGGLGHIPW
GSAFGHHPHIAHPLLLPQNGHGNAGTAASPTEPHHQGRLASAHPEAPALRAPPSGGLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFSSFHLLSPSTPTQAANLGKPYRPWGTEIGAF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagctcacccagactacagctcctcagatagtgagctggacgagaccatcgag
gtggaaaaggagagcgcggacgagaatggaaacttgagttcggcgctgtgttccatgtcc
ccaacgacatcgtcccaggttttggccaggaaaagacggagaggcatcatcgagaagcgc
cgacgagaccgaatcaataacagtttgtctgagctgagaaggctggtacccagtgccttt
gagaagcagggatctgctaagctagaaaaagctgagatcttgcagatgactgtggatcac
ctgaaaatgctgcacactgcaggagggaaaggttattttgacgcgcacgccctggctatg
gactatcggagtttggggtttcgggaatgcctggccgaagttgcccgttatctgagcatc
attgaaggactcgatgcctccgacccgcttcgcgttcgcctggtctcccatctcaacaac
tacgcatcccagcgggaagccgcgagcggcgctcacggtggcctcggacacattccctgg
ggaagtgccttcggacatcacccacacatcgcacaccctctgctgctgccccagaatggc
cacgggaacgctggcaccgcggcgtcacccacggagccgcatcaccagggcaggctggct
tctgcccatccggaggcgccggccttgcgagcgccccctagtggcggcttgggaccggtg
cttcccgtggtgacctcggcctccaaactgtctccaccgctgctctcctctgtggcctcg
ctctcagccttccccttttccttcagctccttccacctactgagcccttcgacacccacg
caggcagcaaaccttggcaagccctatagaccttgggggacagagatcggagctttctaa

KEGG   Mus musculus (mouse): 15214Help
Entry
15214             CDS       T01002                                 

Gene name
Hey2, CHF1, Herp1, Hrt2, bHLHb32, hesr2
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15214 (Hey2)
  09162 Cancer: specific types
   05224 Breast cancer
    15214 (Hey2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    15214 (Hey2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15214 (Hey2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    15214 (Hey2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 15214
NCBI-ProteinID: NP_038932
MGI: 1341884
Ensembl: ENSMUSG00000019789
Vega: OTTMUSG00000038103
UniProt: Q9QUS4 Q0VGJ1
LinkDB All DBs
Position
10; 10 A4
AA seq 339 aa AA seqDB search
MKRPCEETTSESDLDETIDVGSENNYPGHATSSVMRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALATD
FMSIGFRECLTEVARYLSSVEGLDPSDPLRVRLVSHLSTCASQREAAVMTSSMAHHHHPL
HPHHWAAAFHHLPTALLQPNGLHTSESTPCRLSTSSEVPSAHGSALLTATFAHADSALRM
PSGGTVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPSNAAAAAAVA
AATAISPPLSVSAASSPQQTSTGTNNKPYQPWGTEVGAF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcccttgtgaggaaacgacctccgaaagcgacctggacgagaccatcgacgtg
gggagcgagaacaattaccctgggcacgctacaagctcagtgatgaggtccaattcaccg
acaactacctctcagattatggcaagaaagaaaaggagagggatcatagaaaaaaggcgt
cgggatcgaataaataacagtttatctgaattgagaagactagtgccaacagcttttgaa
aaacaaggatctgccaagttagaaaaggctgaaatattgcaaatgacagtggatcatttg
aagatgctccaggctacagggggtaaaggctactttgatgcccatgctcttgccacagac
ttcatgagcattggattccgagagtgcttgacagaagtggctaggtacctaagctcagtg
gaaggccttgacccgtcggacccactacgcgtgcgccttgtctctcatctcagcacctgt
gcctcccagcgggaggcagcagtgatgacatcctccatggcccaccaccatcaccccttg
caccctcaccactgggcagctgctttccaccatctccccacagccctgctccagcccaat
ggactccacacatcagagtcaaccccatgtcgcctatccacatcttcagaagtgccttct
gctcatggctctgctctcctcacagcaacgtttgcccatgcagattctgctcttcggatg
ccatcagggggcaccgttgcaccctgcgtgccacctctctccacctctcttctgtctctt
tcggccactgtgcatgccgcagctgcagcagccactgcagctgcacacagcttccctctg
tccttcgcaggggcttttcccatgctcccgtccaatgcagcggcagcagccgctgttgct
gctgcaacagcaatcagcccacccttgtcggtatccgcagcctccagtcctcagcagaca
agcactgggacaaacaataaaccttaccaaccctgggggacagaagttggagccttttaa

KEGG   Mus musculus (mouse): 56198Help
Entry
56198             CDS       T01002                                 

Gene name
Heyl, Hey3, Hrt3, bHLHb33, hesr3
Definition
(RefSeq) hairy/enhancer-of-split related with YRPW motif-like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56198 (Heyl)
  09162 Cancer: specific types
   05224 Breast cancer
    56198 (Heyl)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56198 (Heyl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56198 (Heyl)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    56198 (Heyl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange
Motif
Other DBs
NCBI-GeneID: 56198
NCBI-ProteinID: NP_038933
MGI: 1860511
Ensembl: ENSMUSG00000032744
Vega: OTTMUSG00000008972
UniProt: Q9DBX7
LinkDB All DBs
Position
4; 4 D2.2
AA seq 326 aa AA seqDB search
MKRPRAPSGSDGESDGPIDVGQENDLSQMARPLTTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHASGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSHADPVRIRLLSHLKSYAAEMEPSPTTTSALAFPVWPWSFL
HSCPGLPSLNSQLAILGRVPGPVLPSISSPPYPISALRSAPVHRPAGTIPPTRRNLLPSR
GVTSTQRAHLPERPAAPPPTALDARAARSIVPIPPCSPTTAPGAGKSDDNVSGSISSPCP
SGPTGRPAGAVFYHSWVSEITEIGAF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcccagggcgcccagtggctccgacggcgagtctgatggacccatcgatgtg
ggtcaagagaacgatcttagccagatggccaggccgctgactacccccagcccttcgcag
atgcaagcccggaagaagcgcagagggatcatagagaaacggcgcagagaccgcatcaac
agtagcctttctgaattgcgacgattggtccccactgcctttgagaaacagggctcctcc
aagctggagaaagctgaggtcttgcagatgaccgtggatcacttgaagatgctccatgcc
tctggtggcacagggttctttgatgcccgagccctggctgttgacttccggagtattggg
tttcgggaatgcctcactgaggtcataagatacctgggggtcctggaaggacccagcagc
catgccgaccctgtccggattcgcctcctctcccacctcaagagctatgcagcagagatg
gagccctcacccacgaccaccagtgccctggcctttcccgtgtggccctggtccttcctg
catagctgtccaggcttgccttccctgaacagtcagctcgccatcctgggaagagtgccc
ggccctgtcctccccagcatctcttctcccccttaccctatctcagccctgaggtcggca
ccagtgcacagacctgctggtaccatccccccaacccggcggaatttgttgcccagccga
ggggtgacttccacccagagagcccatcttcctgagaggccagctgcccctccacccaca
gcccttgatgccagggctgccaggagcatagtcccaatcccaccatgttcccccacaaca
gcccctggagctgggaaatctgatgacaatgtgtctggttctatctccagtccatgtcct
tcagggccaactgggaggcctgcgggagcagtgttctaccactcttgggtctcagaaatc
actgaaattggggctttctga

DBGET integrated database retrieval system