KEGG   Mus musculus (mouse): 15234Help
Entry
15234             CDS       T01002                                 

Gene name
Hgf, C230052L06Rik, HGF/SF, NK1, NK2, SF, SF/HGF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05144  Malaria
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05218  Melanoma
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    15234 (Hgf)
   04015 Rap1 signaling pathway
    15234 (Hgf)
   04010 MAPK signaling pathway
    15234 (Hgf)
   04151 PI3K-Akt signaling pathway
    15234 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    15234 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15234 (Hgf)
   05205 Proteoglycans in cancer
    15234 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    15234 (Hgf)
   05226 Gastric cancer
    15234 (Hgf)
   05218 Melanoma
    15234 (Hgf)
   05211 Renal cell carcinoma
    15234 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    15234 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    15234 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15234 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15234 (Hgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   15234 (Hgf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   15234 (Hgf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kringle Trypsin PAN_1 Ependymin DUF1986 DUF316
Motif
Other DBs
NCBI-GeneID: 15234
NCBI-ProteinID: NP_001276387
MGI: 96079
Ensembl: ENSMUSG00000028864
Vega: OTTMUSG00000055308
UniProt: Q08048 Q8C9G5
LinkDB All DBs
Structure
PDB: 

Position
5 A3; 5 7.07 cM
AA seq 728 aa AA seqDB search
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVP
METTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgtcctcctgcacctc
ctcctgcttcatgtcgccatcccctatgcagaaggacagaagaaaagaagaaatacactt
catgaatttaaaaagtcagcaaaaactactcttaccaaggaagacccattactgaagatt
aaaaccaaaaaagtgaactctgcagatgagtgtgccaacaggtgtatcaggaacaggggc
tttacgttcacttgcaaggccttcgtttttgataagtcaagaaaacgatgctactggtat
cctttcaatagtatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaactgcatcattggtaaaggaggcagctataaagggacg
gtatccatcactaagagtggcatcaaatgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggtgaaagctac
agaggtcccatggatcacacagaatcaggcaagacttgtcagcgctgggaccagcagaca
ccacaccggcacaagttcttgccagaaagatatcccgacaagggctttgatgataattat
tgccgcaatcctgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaacgtgcgctcacagtgctgtgaatgagactgatgtccct
atggaaacaactgaatgcattcaaggccaaggagaaggttacaggggaaccagcaatacc
atttggaatggaattccctgtcagcgttgggattcgcagtaccctcacaagcatgatatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccagatggg
gctgaatcaccatggtgttttaccactgacccaaacatccgagttggctactgctctcaa
attcccaagtgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaattac
atgggcaacttatccaaaacaaggtctggacttacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagatgctagcaaattgaataagaattac
tgccggaatcctgatgatgatgcccatggaccttggtgctacacggggaatcctcttatt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgggttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacagaaataaacatatctgt
ggaggatcattgataaaggaaagttgggttcttactgcaagacaatgttttccagccaga
aacaaagacttgaaagactatgaagcttggcttggcatccacgatgttcatgagagaggc
gaggagaagcgcaagcagatcttaaacatttcccagctggtctatggtcctgaaggctca
gacttggttttactgaagcttgctcgacctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggttgtacaatccctgaaaagaccacttgcagtatttacggctgg
ggctacactggattgatcaacgcggatggtttattacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgagtta
tgtgctggggctgaaaagattggatcaggaccatgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

DBGET integrated database retrieval system