KEGG   Mus musculus (mouse): 15245Help
Entry
15245             CDS       T01002                                 

Gene name
Hhip, Hhip1
Definition
(RefSeq) Hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    15245 (Hhip)
   04024 cAMP signaling pathway
    15245 (Hhip)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15245 (Hhip)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    15245 (Hhip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_rec GSDH EGF_2
Motif
Other DBs
NCBI-GeneID: 15245
NCBI-ProteinID: NP_064655
MGI: 1341847
Ensembl: ENSMUSG00000064325
Vega: OTTMUSG00000031006
UniProt: Q7TN16
LinkDB All DBs
Position
8 C1; 8 37.95 cM
AA seq 700 aa AA seqDB search
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRVMSQLE
LLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQ
SLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCF
PDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSH
RLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGAS
SSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRVTVQP
AQPLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagatgctctcgtttaagctgctactgctggccgtggctctgggcttctttgaa
ggagatgcgaagtttggggaaaggaacgaggggagcggagcgagaaggagacggtgcctg
aatgggaaccccccaaagcgcctaaagagaagggacaggcgggtgatgtcccagctggag
ctgctcagtggaggagagatcctgtgtggtggcttctacccacgagtatcttgctgcctg
cagagtgacagccctggattggggcgtctggagaacaagatcttttctgccaccaacaac
tcagaatgcagcaggctgctggaggagatccaatgtgctccctgctccccgcattcccag
agcctcttctacacacctgaaagagatgtcctggatggggacctagcacttccactcctc
tgcaaagactactgcaaagaattcttttatacttgccgaggccatattccaggtcttctt
caaacaactgctgatgaattttgcttttactatgcaagaaaagatgctgggttatgcttt
ccagacttcccgagaaagcaagtcagaggaccagcatctaactacttgggccagatggaa
gactacgagaaagtgggggggatcagcagaaaacacaaacacaactgcctctgtgtccag
gaggtcatgagtgggctgcggcagcctgtgagcgctgtgcacagcggggatggctcccat
cggctcttcattctagagaaggaaggctacgtgaagattctaaccccagaaggagaactg
ttcaaggagccttacttggacattcacaaacttgttcaaagtggaataaagggaggagac
gaaaggggcctgctaagcctggcattccatcccaattacaagaaaaatggaaagctgtat
gtgtcttataccaccaaccaggaacggtgggctattgggcctcacgaccacattcttcgg
gttgtggaatacacagtatccaggaaaaacccccatcaagttgatgtgagaacagccagg
gtgtttctggaagtcgcagagctccaccgaaagcatcttgggggacagctgctctttggt
cctgatggctttttgtacatcatccttggggatggtatgatcacattggatgacatggaa
gagatggatgggttaagtgacttcacaggctctgtgctgaggctggacgtggacaccgac
atgtgcaatgtgccttattccatacctcggagtaaccctcacttcaacagcaccaaccag
cccccagaagtatttgcccacggcctccatgatccaggcagatgtgccgtggatcgacat
cctactgatataaacatcaatttaacaatactttgctcagattccaacgggaaaaacagg
tcatcagccagaatcctacagataataaagggaagagattatgaaagtgagccatctctt
cttgaattcaagccattcagtaacggccctttggttggtggatttgtttacagaggctgt
cagtctgaaagattgtacggaagctatgtgttcggagatcgcaatgggaatttcttaacc
ctccagcaaagcccagtgaccaagcaatggcaagaaaagccgctctgcctgggtgccagc
agctcctgtcgaggctacttttcgggtcacatcttgggatttggagaagatgaattagga
gaggtttacattctatcaagcagtaagagtatgacccagactcacaatggaaaactctac
aagatcgtagaccccaaaagacctttaatgcctgaggaatgcagagtcacagttcaacct
gcccagccactgacctccgattgctcccggctctgtcgaaacggctactacacccccact
ggcaagtgctgctgcagtcccggctgggagggagacttctgcagaattgccaagtgtgag
ccagcgtgccgtcatggaggtgtctgtgtcagaccgaacaagtgcctctgtaaaaagggc
tatcttggtcctcaatgtgaacaagtggacaggaacgtccgcagagtgaccagggcaggt
atccttgatcagatcattgacatgacgtcttacttgctggatctcacaagttacattgta
tag

DBGET integrated database retrieval system