KEGG   Mus musculus (mouse): 15275Help
Entry
15275             CDS       T01002                                 

Gene name
Hk1, BB404130, Hk-1, Hk1-s, dea, mHk1-s
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu00524  Neomycin, kanamycin and gentamicin biosynthesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04066  HIF-1 signaling pathway
mmu04910  Insulin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04973  Carbohydrate digestion and absorption
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    15275 (Hk1)
   00051 Fructose and mannose metabolism
    15275 (Hk1)
   00052 Galactose metabolism
    15275 (Hk1)
   00500 Starch and sucrose metabolism
    15275 (Hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    15275 (Hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    15275 (Hk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    15275 (Hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    15275 (Hk1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    15275 (Hk1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    15275 (Hk1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    15275 (Hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15275 (Hk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     15275 (Hk1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    15275 (Hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 15275
NCBI-ProteinID: NP_001139572
MGI: 96103
Ensembl: ENSMUSG00000037012
Vega: OTTMUSG00000034151
UniProt: Q6GQU1 Q3TTB4
LinkDB All DBs
Position
10 B4; 10 32.37 cM
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVH
GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTRLG
VEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMH
PQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLSHFRLS
KQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDD
IRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKG
AALITAVGVRLRGDPTNA
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcaactactggcatattacttcaccgagctgaaggatgaccaagtcaaa
aagattgataagtatctgtatgccatgcggctctctgatgaaattctgatagatatcctg
acacgcttcaagaaagagatgaagaatggcctctcccgggattataacccaacggcctcc
gtcaagatgctgccaacctttgtccggtccattccggacggctcagaaaagggggatttc
attgcactggatctcggcgggtcttcctttcgaatcctgcgggtgcaggtgaaccacgag
aagagtcagaacgtcagcatggagtctgaggtctacgacaccccagagaacatcgtgcac
ggcagtggaagccagctttttgatcacgtcgctgaatgcctcggagacttcatggagaaa
aggaagatcaaggacaagaaattacccgtgggattcacgttttccttcccgtgccgacaa
tccaaaatagacgaggccgtactgatcacgtggacaaagcggttcaaagccagtggcgtg
gaaggggcggatgtggtcaagctgctgaataaagccattaagaagcgaggggactatgac
gctaacattgtagctgtggtgaatgacacagtggggaccatgatgacctgcggctacgat
gaccaacagtgtgaagtcggcctgatcattggcactggcaccaatgcttgctacatggag
gaactgcgacacatcgacctggtggaaggcgatgaggggaggatgtgtattaacacggaa
tggggagcctttggggatgatgggtccctggaagacattcgaacagagtttgacagagag
ttagaccggggatccctcaaccctgggaaacagctgttcgagaagatggtgagcggcatg
tacatgggggagctggtccggctgatcctggtgaagatggccaaggaaagcctcttattt
gaagggcgcattactccagagctgctcacgaggggcaagttcaccactagcgacgtagcc
gccattgaaacggataaggaaggcgttcaaaatgccaaggaaatcttgacccgcctggga
gtggagccgtctcacgatgactgcgtatcggtccagcacgtatgcacgatcgtctccttc
cgatcagccaacctggtggctgccacgctcggtgccatcttgaaccgcctgcgggacaat
aagggcacgcccaggctgcggaccacagttggcgtagacggttctctctacaagatgcac
ccacagtattcccggcggttccacaagaccctgaggcgcctggtgcctgactcggacgtc
cggttcctcctctcggagagtggcagtggcaagggagccgccatggtgaccgctgtggcc
taccgcctggccgagcagcaccggcagattgaggaaaccctgtcccacttccgcctcagc
aagcaggcactgatggaggtgaagaagaagctgcggtcagagatggaaatggggctgaga
aaggagaccaacagcagagctacggtcaaaatgctgccttcttatgttcggagcatccca
gatgggactgagcatggtgacttcctggccttggatctcggaggaacgaatttccgagtc
ctactggtaaagatccgtagtgggaaaaagagaacagtggagatgcacaacaagatctac
tccattcccctggaaatcatgcagggcaccggggatgagctgtttgatcacattgtctcc
tgcatctccgacttcctggactacatggggatcaaaggcccccggatgcctctgggcttc
accttctcgtttccctgcaagcagacgagcctagattgcggaatcttgatcacgtggaca
aagggattcaaagccaccgactgtgtgggtcacgatgtagccactttactgagggatgct
gtaaaaaggagagaggaatttgacctggatgtggtggctgtggtcaacgacaccgtgggc
accatgatgacttgtgcttatgaagaaccttcttgtgagattggactcatcgtggggact
ggcagcaatgcctgctacatggaggagatgaaaaacgtggagatggtggaggggaaccag
ggccagatgtgcatcaatatggaatggggtgcctttggtgacaacggctgtctggacgac
atcagaacagacttcgacaaagtggtggacgaatattctctaaacagtgggaaacaaagg
tttgagaagatgatcagtggaatgtacctgggtgagatcgtccgtaacatcctgattgac
ttcaccaagaaaggcttcctcttccggggacagatctctgagccactcaagacccgaggc
atcttcgagaccaagtttctctctcagatcgagagtgaccgattagcgctgctccaggtg
cgggccatccttcagcagctgggtctaaacagcacgtgcgacgacagtatcctggtcaag
accgtgtgtggggtggtgtccaagcgggcggcccagctgtgtggtgccggcatggccgcc
gtggtggaaaagatccgagagaacagaggcctagaccacctgaatgtaaccgtgggcgtg
gacgggacgctctacaaactccatccacacttctccagaatcatgcaccaaacagtgaag
gaactgtcaccaaagtgtaccgtgtccttcctcctgtctgaagacggcagcggcaagggg
gccgcccttatcacagctgtgggcgtgcggctcagaggagaccctacgaacgcctaa

DBGET integrated database retrieval system