KEGG   Mus musculus (mouse): 15368Help
Entry
15368             CDS       T01002                                 

Gene name
Hmox1, D8Wsu38e, HO-1, HO1, Hemox, Hmox, Hsp32
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
mmu04066  HIF-1 signaling pathway
mmu04216  Ferroptosis
mmu04978  Mineral absorption
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    15368 (Hmox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    15368 (Hmox1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    15368 (Hmox1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    15368 (Hmox1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15368 (Hmox1)
   05206 MicroRNAs in cancer
    15368 (Hmox1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    15368 (Hmox1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    15368 (Hmox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     15368 (Hmox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Heme_oxygenase
Motif
Other DBs
NCBI-GeneID: 15368
NCBI-ProteinID: NP_034572
MGI: 96163
Ensembl: ENSMUSG00000005413
Vega: OTTMUSG00000030644
UniProt: P14901 Q3U5U6
LinkDB All DBs
Position
8 35.59 cM; 8 C1
AA seq 289 aa AA seqDB search
MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTA
LEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHE
VGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQ
LYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRP
ASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtccacagcccgacagcatgccccaggatttgtctgaggccttgaaggaggcc
accaaggaggtacacatccaagccgagaatgctgagttcatgaagaactttcagaagggt
caggtgtccagagaaggctttaagctggtgatggcttccttgtaccatatctacacggcc
ctggaagaggagatagagcgcaacaagcagaacccagtctatgccccactctacttccct
gaggagctgcaccgaagggctgccctggagcaggacatggccttctggtatgggcctcac
tggcaggaaatcatcccttgcacgccagccacacagcactatgtaaagcgtctccacgag
gtggggcgcactcaccctgagctgctggtggcccacgcatatacccgctacctgggtgac
ctctcagggggtcaggtcctgaagaagattgcacagaaggccatggccttgcccagctct
ggggagggcctggctttttttaccttcccgaacatcgacagccccaccaagttcaaacag
ctctatcgtgctcgaatgaacactctggagatgacacctgaggtcaagcacagggtgaca
gaagaggctaagaccgccttcctgctcaacattgagctgtttgaggagctgcaggtgatg
ctgacagaggaacacaaagaccagagtccctcacagatggcgtcacttcgtcagaggcct
gctagcctggtgcaagatactgcccctgcagagacaccccgagggaaaccccagatcagc
actagctcatcccagacaccgctcctccagtgggtcctcactctcagcttcctgttggca
acagtggcagtgggaatttatgccatgtaa

DBGET integrated database retrieval system