KEGG   Mus musculus (mouse): 15370Help
Entry
15370             CDS       T01002                                 

Gene name
Nr4a1, GFRP1, Gfrp, Hbr-1, Hbr1, Hmr, N10, NGFI-B, NGFIB, NP10, NUR77-1, NUR77-2, TIS1, TR3, nur77
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15370 (Nr4a1)
   04151 PI3K-Akt signaling pathway
    15370 (Nr4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    15370 (Nr4a1)
   04927 Cortisol synthesis and secretion
    15370 (Nr4a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    15370 (Nr4a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15370 (Nr4a1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    15370 (Nr4a1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    15370 (Nr4a1)
Nuclear receptors [BR:mmu03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   15370 (Nr4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 15370
NCBI-ProteinID: NP_034574
MGI: 1352454
Ensembl: ENSMUSG00000023034
UniProt: P12813 Q545Q1
LinkDB All DBs
Position
15; 15 F1
AA seq 601 aa AA seqDB search
MPCIQAQYGTPATSPGPRDHLTGDPLALEFGKPTMDLASPETAPAAPATLPSFSTFMDGY
TGEFDTFLYQLPGTTQPCSSACSSASSTSSSSSSATSPASASFKFEDFQVYGCYPGTLSG
PLDETLSSSGSEYYGSPCSAPSPSTPNFQPSQLSPWDGSFGHFSPSQTYEGLWAWTEQLP
KASSGPPPPPTFFSFSPPTGPSPSLAQSSLKLFPPPATHQLGEGESYSMPAAFPGLAPTS
PNRDTSGILDAPVTSTKSRSGASGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQK
SAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPP
DASPTNLLTSLIRAHLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSGSLDVI
RKWAEKIPGFIELCPGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHQLQCAR
GFGDWIDNILAFSRSLHSLGVDVPAFACLSALVLITDRHGLQDPRRVEELQNRIASCLKE
HMATVAGDPQPASCLSRLLGKLPELRTLCTQGLQRIFCLKLEDLVPPPPIVDKIFMDTLS
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtattcaagctcaatatggaacaccagcaacgagcccaggaccgcgtgaccac
ctgaccggtgatcccctggcccttgagttcggcaagcctaccatggacctggccagcccc
gagacagcacctgccgcacctgctacactgcccagcttcagcaccttcatggacgggtac
accggagagtttgacaccttcctctaccagctgccggggacgacccagccgtgctcctca
gcttgttcctctgcctcctccacgtcttcttcctcatcctcggccacctcccccgcttcg
gcgtccttcaagtttgaggacttccaggtgtacggctgctacccgggcaccctgagcggc
ccattagatgagaccctatcctccagcggctctgagtactatggcagtccctgctcagcc
ccctcgccatctacacccaacttccagccgtcccagctttctccctgggacggctcattt
ggccacttctccccgagccagacttatgaaggcctctgggcatggacagagcagttgcct
aaggcttcttcagggcctccgccacctccaaccttcttctccttcagtcctcccactggc
cccagccccagcctggcccagagttctctgaaattgttcccaccaccagccacccaccag
cttggggagggggagagctattccatgccagcagctttccccggcttggcacccacctct
ccgaaccgtgacacttccggcattctggacgcacccgtgacctccaccaagtcccggagc
ggggcttcaggtggcagcgagggccgctgtgcagtctgtggtgacaatgcttcgtgtcag
cactatggggtccgcacctgtgagggctgcaagggcttcttcaagcgcacagtacagaaa
agcgccaagtacatctgcctggcaaacaaggattgccctgtggacaagaggcggcggaac
cgctgccagttctgccgcttccagaagtgcctggctgtgggcatggtgaaggaagttgta
cggacagacagcctaaaagggcggcggggccggctaccttcaaaacccaagcagcctcca
gatgcctcccctaccaatcttctcacttccctcatccgggcacacttggactccgggcct
agcactgccaaattggactattccaagttccaggaactggtgctgccccgcttcgggaag
gaagatgccggtgacgtgcaacaattttatgacttgctctctggttccctggacgttatc
cgaaagtgggcagaaaaaatccctggcttcattgagctttgcccaggagaccaagacctg
ttgctagagtctgccttcctggaactcttcatcctccgcctggcataccgatctaaaccc
ggtgaggggaagctcatcttctgctcaggcctggtactacaccagctgcagtgtgcccgt
ggctttggtgattggattgacaacatcctggccttctcacggtccctgcacagcttgggt
gttgatgttcccgcctttgcctgcctgtccgctctggtcctcatcactgatcgacacggg
ctccaggaccctcgtcgggtggaagagctgcagaatcgcattgctagctgtctgaaggag
cacatggctaccgtggcaggagacccacagccggccagctgcctgtcacgtctgctgggc
aaactgcctgagcttcggaccctgtgcactcaaggcctgcagcgcatcttttgcctcaag
ttggaggacttggtaccccctccacctattgtggacaagatctttatggacacattgtct
ttctga

DBGET integrated database retrieval system