KEGG   Mus musculus (mouse): 15378Help
Entry
15378             CDS       T01002                                 

Gene name
Hnf4a, HNF-4, Hnf4, Hnf4alpha, MODY1, Nr2a1, TCF-14, Tcf14
Definition
(RefSeq) hepatic nuclear factor 4, alpha
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04152  AMPK signaling pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    15378 (Hnf4a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15378 (Hnf4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15378 (Hnf4a)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    15378 (Hnf4a)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    15378 (Hnf4a)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   15378 (Hnf4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 15378
NCBI-ProteinID: NP_032287
MGI: 109128
Ensembl: ENSMUSG00000017950
Vega: OTTMUSG00000001071
UniProt: P49698
LinkDB All DBs
Position
2 H3; 2 84.32 cM
AA seq 474 aa AA seqDB search
MRLSKTLAGMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKK
IANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSASDAPHTHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW
PRPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctctaaaacccttgccggcatggatatggccgactacagcgctgccctggac
ccagcctacaccaccctggagtttgaaaatgtgcaggtgttgaccatgggcaatgacacg
tccccatctgaaggtgccaacctcaattcatccaacagcctgggcgtcagtgccctgtgc
gccatctgtggcgaccgggccaccggcaaacactacggagcctcgagctgtgacggctgc
aaggggttcttcaggaggagcgtgaggaagaaccacatgtactcctgcaggtttagccga
caatgtgtggtagacaaagataagaggaaccagtgtcgttactgcaggcttaagaagtgc
ttccgggctggcatgaagaaggaagctgtccaaaatgagcgggaccggatcagcacgcgg
aggtcaagctacgaggacagcagcctgccctccatcaacgcgctcctgcaggcagaggtt
ctgtcccagcagatcacctctcccatctctgggatcaatggcgacattcgggcaaagaag
attgccaacatcacagacgtgtgtgagtctatgaaggagcagctgctggtcctggtcgag
tgggccaagtacatcccggccttctgcgaactccttctggatgaccaggtggcgctgctc
agggcccacgccggtgagcatctgctgcttggagccaccaagaggtccatggtgtttaag
gacgtgctgctcctaggcaatgactacatcgtccctcggcactgtccagagctagcggag
atgagccgtgtgtccatccgcatcctcgatgagctggtcctgcccttccaagagctgcag
attgatgacaatgaatatgcctgcctcaaagccatcatcttctttgatccagatgccaag
gggctgagtgacccgggcaagatcaagcggctgcggtcacaggtgcaagtgagcctggag
gattacatcaacgaccggcagtacgactctcggggccgctttggagagctgctgctgctg
ttgcccacgctgcagagcatcacctggcagatgatcgaacagatccagttcatcaagctc
ttcggcatggccaagattgacaacctgctgcaggagatgcttctcggagggtctgccagt
gatgcaccccacacccaccaccccctgcaccctcacctgatgcaagaacacatgggcacc
aatgtcattgttgctaacacgatgccctctcacctcagcaatggacagatgtgtgagtgg
ccccgacccagggggcaggcagccactcccgagactccacagccatcaccaccaagtggc
tcgggatctgaatcctacaagctcctgccaggagccatcaccaccatcgtcaagcctccc
tctgccattccccagccaacgatcaccaagcaagaagccatctag

DBGET integrated database retrieval system