KEGG   Mus musculus (mouse): 15379Help
Entry
15379             CDS       T01002                                 

Gene name
Onecut1, D9Ertd423e, HNF-6, Hfh12, Hnf6, Hnf6b, OC-1, Oc1
Definition
(RefSeq) one cut domain, family member 1
  KO
K08026  one cut domain, family member 1, hepatocyte nuclear factor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15379 (Onecut1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15379 (Onecut1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUT Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 15379
NCBI-ProteinID: NP_032288
MGI: 1196423
Ensembl: ENSMUSG00000043013
Vega: OTTMUSG00000034722
UniProt: O08755
LinkDB All DBs
Structure
PDB: 

Position
9 D; 9 41.93 cM
AA seq 465 aa AA seqDB search
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVGHRGSHLPPAHPRSMGMASLLD
GGSGGSDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD
KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS
PLSGSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG
MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR
ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ
RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ
QLGLELSTVSNFFMNARRRSLDKWQDEGGSNSGSSSSSSSTCTKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacagctgaccatggaggcgatcggcgagctgcacggggtgagccatgagccg
gtgcccgcccctgctgacctgctgggcggcagccctcacgcgcgcagctccgtgggacac
cgcggcagccacctgcctcccgcgcacccgcgttccatgggcatggcgtccctgctggac
ggcggcagcggaggcagcgattaccaccaccaccaccgcgcccctgagcacagcttggct
ggccccctgcaccccaccatgaccatggcctgtgaaactcccccaggtatgagcatgccc
accacctacactaccttaacccctctgcagccgctgccgcccatctccaccgtgtccgac
aagttccctcaccatcatcaccaccaccatcaccaccaccacccacaccaccaccagcgc
ctggcgggcaacgtgagcggtagtttcacacttatgcgggatgagcgcgggctggcctct
atgaataacctctataccccctaccacaaggacgtggctggcatgggccagagcctctcg
cccctctctggctccggtctgggcagcattcacaactcccagcaaggacttccccactat
gctcatcccggcgcggctatgcccaccgacaagatgctcaccccaaatggctttgaagcc
caccaccctgccatgctcggtcgccacggggagcagcacctcacgcccacctcggccggc
atggtacccatcaacggccttcctccgcaccatcctcatgcccacctgaatgcccagggc
cacggacagctcctgggcacagcccgagagcccaacccttcggtgaccggcgcgcaggtc
agcaatggaagtaattcagggcagatggaagagatcaataccaaagaggtggcgcagcgt
atcaccaccgagctcaaacgttacagcatcccacaggccatcttcgcgcagagggtgctc
tgccgttcccaggggaccctttcggacctgctgcgaaaccccaagccctggagcaaactc
aagtcgggtcgggagaccttccggaggatgtggaagtggctgcaggagccggagttccag
cgcatgtcggcgctccgcttagcagcctgcaaacggaaagagcaagaacacgggaaggac
agaggcaacacccccaaaaagcccaggctggtcttcacagacgtccaacgtcgaactcta
catgcaatattcaaggaaaataagcgtccgtccaaagaattacaaatcaccatctcccag
cagctggggttggagctgagcactgtcagcaacttcttcatgaatgccaggaggaggagt
ctggacaagtggcaggacgagggcggctccaactcaggcagttcatcgtcctcatcgagc
acttgtaccaaagcatga

DBGET integrated database retrieval system