KEGG   Mus musculus (mouse): 15407Help
Entry
15407             CDS       T01002                                 

Gene name
Hoxb1, Hox-2.9
Definition
(RefSeq) homeobox B1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15407 (Hoxb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15407 (Hoxb1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    15407 (Hoxb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 15407
NCBI-ProteinID: NP_032292
MGI: 96182
Ensembl: ENSMUSG00000018973
Vega: OTTMUSG00000001776
UniProt: P17919
LinkDB All DBs
Position
11 D; 11 59.86 cM
AA seq 297 aa AA seqDB search
MDYNRMSSFLEYPLCNRGPSAYSAPTSFPPCSAPAVDSYAGESRYGGGLPSSALQQNSGY
PVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSSYGAQLGGL
PDSYGAGGVGSGPYPPPQPPYGTEQTATFASAYDLLSEDKESPCSSEPSTLTPRTFDWMK
VKRNPPKTAKVSELGLGAPGGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNE
TQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPEASPSSITS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggactataataggatgagttcctttttagagtacccactttgtaaccggggacccagc
gcctacagcgccccaacctcttttcccccctgctcagctccggccgttgacagctacgca
ggggagagccgctatggtggagggctgcctagctcagcgctccaacaaaactcggggtat
cctgtccagcagccgccgtcatccctgggggtgtcctttcccagccccgctccctcgggg
tacgccccagccgcctgcaaccccagctatgggccttctcagtattattctgtgggtcag
tcggaaggagatggaagctattttcatccgtcgagctacggagcccagctaggggggttg
cccgacagctatggagcgggtggagtcggctcagggccatatcctccgccgcagccccca
tacggaactgagcagaccgcaacctttgcatcagcctacgacctcctctctgaggacaag
gaatcgccttgctcgtcagaacccagcactctcactccccggaccttcgactggatgaag
gtcaagagaaacccacctaagacagcgaaggtgtccgagctgggactgggcgctcccggc
ggtctccgcacaaacttcaccacgcgccagctgacggagctggagaaggaatttcatttc
aacaaatacctgagccgtgcccggagggtggagatcgccgccaccctggagctcaatgaa
acgcaggtgaagatctggttccagaaccggcgcatgaagcagaagaaacgcgagcgagag
gggggcaggatgcctgcaggccccccaggttgcccaaaggaagccgctggagatgcctct
gaccagtccgcgtgcacctccccagaagcctcgcccagttccatcacctcttga

DBGET integrated database retrieval system