KEGG   Mus musculus (mouse): 15894Help
Entry
15894             CDS       T01002                                 

Gene name
Icam1, CD54, Icam-1, Ly-47, MALA-2
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05150  Staphylococcus aureus infection
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05323  Rheumatoid arthritis
mmu05416  Viral myocarditis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    15894 (Icam1)
   04668 TNF signaling pathway
    15894 (Icam1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    15894 (Icam1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15894 (Icam1)
   04670 Leukocyte transendothelial migration
    15894 (Icam1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    15894 (Icam1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    15894 (Icam1)
   05416 Viral myocarditis
    15894 (Icam1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    15894 (Icam1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    15894 (Icam1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15894 (Icam1)
   05164 Influenza A
    15894 (Icam1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15894 (Icam1)
   05169 Epstein-Barr virus infection
    15894 (Icam1)
  09174 Infectious disease: parasitic
   05144 Malaria
    15894 (Icam1)
   05143 African trypanosomiasis
    15894 (Icam1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15894 (Icam1)
   04090 CD molecules [BR:mmu04090]
    15894 (Icam1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15894 (Icam1)
   04091 Lectins [BR:mmu04091]
    15894 (Icam1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15894 (Icam1)
CD molecules [BR:mmu04090]
 Proteins
  15894 (Icam1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   15894 (Icam1)
Lectins [BR:mmu04091]
 I-type lectins (Siglecs)
  15894 (Icam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Ig_3 C2-set_2 Ig_4 Tad C6 DUF4448
Motif
Other DBs
NCBI-GeneID: 15894
NCBI-ProteinID: NP_034623
MGI: 96392
Ensembl: ENSMUSG00000037405
Vega: OTTMUSG00000063048
UniProt: P13597 Q3U8M7
LinkDB All DBs
Position
9 A3; 9 7.69 cM
AA seq 537 aa AA seqDB search
MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPREAFLPQGGSVQVNCSSSCKEDLSLGL
ETQWLKDELESGPNWKLFELSEIGEDSSPLCFENCGTVQSSASATITVYSFPESVELRPL
PAWQQVGKDLTLRCHVDGGAPRTQLSAVLLRGEEILSRQPVGGHPKDPKEITFTVLASRG
DHGANFSCRTELDLRPQGLALFSNVSEARSLRTFDLPATIPKLDTPDLLEVGTQQKLFCS
LEGLFPASEARIYLELGGQMPTQESTNSSDSVSATALVEVTEEFDRTLPLRCVLELADQI
LETQRTLTVYNFSAPVLTLSQLEVSEGSQVTVKCEAHSGSKVVLLSGVEPRPPTPQVQFT
LNASSEDHKRSFFCSAALEVAGKFLFKNQTLELHVLYGPRLDETDCLGNWTWQEGSQQTL
KCQAWGNPSPKMTCRRKADGALLPIGVVKSVKQEMNGTYVCHAFSSHGNVTRNVYLTVLY
HSQNNWTIIILVPVLLVIVGLVMAASYVYNRQRKIRIYKLQKAQEEAIKLKGQAPPP
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacccgtgccaagcccacgctacctctgctcctggccctggtcaccgttgtg
atccctgggcctggtgatgctcaggtatccatccatcccagagaagccttcctgccccag
ggtgggtccgtgcaggtgaactgttcttcctcatgcaaggaggacctcagcctgggcttg
gagactcagtggctgaaagatgagctcgagagtggacccaactggaagctgtttgagctg
agcgagatcggggaggacagcagtccgctgtgctttgagaactgtggcaccgtgcagtcg
tccgcttccgctaccatcaccgtgtattcgtttccggagagtgtggagctgagacctctg
ccagcctggcagcaagtaggcaaggacctcaccctgcgctgccacgtggatggtggagca
ccgcggacccagctctcagcagtgctgctccgtggggaggagatactgagccgccagcca
gtgggtgggcaccccaaggaccccaaggagatcacattcacggtgctggctagcagaggg
gaccacggagccaatttctcatgccgcacagaactggatctcaggccgcaagggctggca
ttgttctctaatgtctccgaggccaggagcctccggactttcgatcttccagctaccatc
ccaaagctcgacacccctgacctcctggaggtgggcacccagcagaagttgttttgctcc
ctggaaggcctgtttcctgcctctgaagctcggatatacctggagctgggaggccagatg
ccgacccaggagagcacaaacagcagtgactctgtgtcagccactgccttggtagaggtg
actgaggagttcgacagaaccctgccgctgcgctgcgttttggagctagcggaccagatc
ctggagacgcagaggaccttaacagtctacaacttttcagctccggtcctgaccctgagc
cagctggaggtctcggaagggagccaagtaactgtgaagtgtgaagcccacagtgggtcg
aaggtggttcttctgagcggcgtcgagcctaggccacccaccccgcaggtccaattcaca
ctgaatgccagctcggaggatcacaaacgaagcttcttttgctctgccgctctggaggtg
gcgggaaagttcctgtttaaaaaccagaccctggaactgcacgtgctgtatggtcctcgg
ctggacgagacggactgcttggggaactggacctggcaagaggggtctcagcagactctg
aaatgccaggcctgggggaacccatctcctaagatgacctgcagacggaaggcagatggt
gccctgctgcccatcggggtggtgaagtctgtcaaacaggagatgaatggtacatacgtg
tgccatgcctttagctcccatgggaatgtcaccaggaatgtgtacctgacagtactgtac
cactctcaaaataactggactataatcattctggtgccagtactgctggtcattgtgggc
ctcgtgatggcagcctcttatgtttataaccgccagagaaagatcaggatatacaagtta
cagaaggctcaggaggaggccataaaactcaagggacaagccccacctccctga

DBGET integrated database retrieval system