KEGG   Mus musculus (mouse): 15901Help
Entry
15901             CDS       T01002                                 

Gene name
Id1, AI323524, D2Wsu140e, Idb1, bHLHb24
Definition
(RefSeq) inhibitor of DNA binding 1, HLH protein
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    15901 (Id1)
   04350 TGF-beta signaling pathway
    15901 (Id1)
   04390 Hippo signaling pathway
    15901 (Id1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15901 (Id1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15901 (Id1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    15901 (Id1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Dsl1_N PTR
Motif
Other DBs
NCBI-GeneID: 15901
NCBI-ProteinID: NP_001342042
MGI: 96396
Ensembl: ENSMUSG00000042745
Vega: OTTMUSG00000015813
LinkDB All DBs
Structure
PDB: 

Position
2 H1; 2 75.41 cM
AA seq 154 aa AA seqDB search
MKVASGSAAAAAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY
DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRA
PLSTLNGEISALAAEVRRHVFQPTIASCVAEAAH
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgccagtggcagtgccgcagccgctgcaggccctagctgttcgctgaaggcg
ggcaggacagcgggcgaggtggtacttggtctgtcggagcaaagcgtggccatctcgcgc
tgcgctgggacgcgcctgcccgccttgctggacgagcagcaggtgaacgtcctgctctac
gacatgaacggctgctactcacgcctcaaggagctggtgcccaccctgccccagaaccgc
aaagtgagcaaggtggagatcctgcagcatgtaatcgactacatcagggacctgcagctg
gagctgaactcggagtctgaagtcgggaccaccggaggccggggactgcctgtccgcgcc
ccgctcagcaccctgaacggcgagatcagtgccttggcggccgaggtgaggcggcatgtg
ttccagccgacgatcgcatcttgtgtcgctgaggcggcgcactga

KEGG   Mus musculus (mouse): 15902Help
Entry
15902             CDS       T01002                                 

Gene name
Id2, AI255428, C78922, Idb2, bHLHb26
Definition
(RefSeq) inhibitor of DNA binding 2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    15902 (Id2)
   04390 Hippo signaling pathway
    15902 (Id2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15902 (Id2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15902 (Id2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15902 (Id2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    15902 (Id2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 15902
NCBI-ProteinID: NP_034626
MGI: 96397
Ensembl: ENSMUSG00000020644
UniProt: P41136 Q545T4
LinkDB All DBs
Position
12 A1.3; 12 8.57 cM
AA seq 134 aa AA seqDB search
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVT
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKVLCG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcagtccggtgaggtccgttaggaaaaacagcctgtcggaccacagcttg
ggcatctcccggagcaaaaccccggtggacgacccgatgagtctgctctacaacatgaac
gactgctactccaagctcaaggaactggtgcccagcatcccccagaacaagaaggtgacc
aagatggaaatcctgcagcacgtcatcgattacatcttggacctgcagatcgccctggac
tcgcatcccactatcgtcagcctgcatcaccagagacctggacagaaccaggcgtccagg
acgccgctgaccaccctgaacacggacatcagcatcctgtccttgcaggcatctgaattc
ccttctgagcttatgtcgaatgatagcaaagtactctgtggctaa

KEGG   Mus musculus (mouse): 15903Help
Entry
15903             CDS       T01002                                 

Gene name
Id3, Hlh462, Idb3, bHLHb25
Definition
(RefSeq) inhibitor of DNA binding 3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    15903 (Id3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15903 (Id3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15903 (Id3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    15903 (Id3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 15903
NCBI-ProteinID: NP_032347
MGI: 96398
Ensembl: ENSMUSG00000007872
Vega: OTTMUSG00000009864
UniProt: P41133 Q545W1
LinkDB All DBs
Position
4 D3; 4 68.34 cM
AA seq 119 aa AA seqDB search
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPSTEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISKDKRSFCH
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgagcccggtgcgcggctgctacgaggcggtgtgctgcctgtcggaacgt
agcctggccattgcgcgaggccgcggtaagagcccgtcgaccgaggagcctcttagcctc
ttggacgacatgaaccactgctactcgcgcctgcgggaactggtgccgggagtcccgcga
ggcactcagcttagccaggtggaaatcctgcagcgtgtcatagactacatcctcgacctt
caggtggtcctggcagagccggcgcctggacccccggacggtccgcatctcccgatccag
acagctgagctcactccggaacttgtgatctccaaggacaagaggagcttttgccactga

KEGG   Mus musculus (mouse): 15904Help
Entry
15904             CDS       T01002                                 

Gene name
Id4, Idb4, bHLHb27
Definition
(RefSeq) inhibitor of DNA binding 4
  KO
K17695  DNA-binding protein inhibitor ID4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    15904 (Id4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    15904 (Id4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15904 (Id4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    15904 (Id4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 15904
NCBI-ProteinID: NP_112443
MGI: 99414
Ensembl: ENSMUSG00000021379
UniProt: P41139 Q544D2
LinkDB All DBs
Position
13 A5; 13 24.71 cM
AA seq 161 aa AA seqDB search
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEP
ALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP
PAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgagcccggtgcgcccctcgggccgcaaggcgccgtcgggctgcggcggc
ggggagctggcgctacgctgcctggcggagcacggccacagcctgggtggctcggcagcc
gccgccgccgctgcggcggccgcgcgctgcaaggcggccgaggcggcggccgatgagccg
gcgctgtgcctgcagtgcgatatgaacgactgctacagtcgcctgcggaggctcgtgcct
accatcccgcccaacaagaaagtcagcaaagtggagatcctgcagcacgttatcgactac
atcctggacctgcagctggcgctggagactcaccctgctttgctgagacagccgccaccg
cccgcgccacctctccacccggccggggcttgtccggtcgcgccgccgcggaccccactc
accgcgctcaacactgacccggccggcgccgtgaacaagcagggtgacagcattctctgc
cgctga

DBGET integrated database retrieval system