KEGG   Mus musculus (mouse): 15945
Entry
15945             CDS       T01002                                 

Gene name
Cxcl10, C7, CRG-, CRG-2, IN, INP10, IP, IP-, IP-10, IP10, Ifi, Ifi10, Scyb1, Scyb10, gIP-, gIP-10, mob-, mob-1
Definition
(RefSeq) chemokine (C-X-C motif) ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    15945 (Cxcl10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15945 (Cxcl10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    15945 (Cxcl10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15945 (Cxcl10)
   04622 RIG-I-like receptor signaling pathway
    15945 (Cxcl10)
   04623 Cytosolic DNA-sensing pathway
    15945 (Cxcl10)
   04657 IL-17 signaling pathway
    15945 (Cxcl10)
   04062 Chemokine signaling pathway
    15945 (Cxcl10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    15945 (Cxcl10)
   05171 Coronavirus disease - COVID-19
    15945 (Cxcl10)
   05164 Influenza A
    15945 (Cxcl10)
   05169 Epstein-Barr virus infection
    15945 (Cxcl10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15945 (Cxcl10)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15945 (Cxcl10)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   15945 (Cxcl10)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Chemokines
   15945 (Cxcl10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 15945
NCBI-ProteinID: NP_067249
MGI: 1352450
Ensembl: ENSMUSG00000034855
Vega: OTTMUSG00000028740
UniProt: P17515 Q548V9
LinkDB
Structure
PDB: 
2R3Z

Position
5 E2; 5 46.57 cM
AA seq 98 aa
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRV
EIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaacccaagtgctgccgtcattttctgcctcatcctgctgggtctgagtgggactcaa
gggatccctctcgcaaggacggtccgctgcaactgcatccatatcgatgacgggccagtg
agaatgagggccatagggaagcttgaaatcatccctgcgagcctatcctgcccacgtgtt
gagatcattgccacgatgaaaaagaatgatgagcagagatgtctgaatccggaatctaag
accatcaagaatttaatgaaagcgtttagccaaaaaaggtctaaaagggctccttaa

DBGET integrated database retrieval system