KEGG   Mus musculus (mouse): 15962
Entry
15962             CDS       T01002                                 

Gene name
Ifna1, If, Ifa1
Definition
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15962 (Ifna1)
   04151 PI3K-Akt signaling pathway
    15962 (Ifna1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15962 (Ifna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15962 (Ifna1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15962 (Ifna1)
   04621 NOD-like receptor signaling pathway
    15962 (Ifna1)
   04622 RIG-I-like receptor signaling pathway
    15962 (Ifna1)
   04623 Cytosolic DNA-sensing pathway
    15962 (Ifna1)
   04650 Natural killer cell mediated cytotoxicity
    15962 (Ifna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15962 (Ifna1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15962 (Ifna1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15962 (Ifna1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15962 (Ifna1)
   05161 Hepatitis B
    15962 (Ifna1)
   05160 Hepatitis C
    15962 (Ifna1)
   05171 Coronavirus disease - COVID-19
    15962 (Ifna1)
   05164 Influenza A
    15962 (Ifna1)
   05162 Measles
    15962 (Ifna1)
   05168 Herpes simplex virus 1 infection
    15962 (Ifna1)
   05163 Human cytomegalovirus infection
    15962 (Ifna1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15962 (Ifna1)
   05169 Epstein-Barr virus infection
    15962 (Ifna1)
   05165 Human papillomavirus infection
    15962 (Ifna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15962 (Ifna1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15962 (Ifna1)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 15962
NCBI-ProteinID: NP_034632
MGI: 107668
Ensembl: ENSMUSG00000095498
Vega: OTTMUSG00000007695
UniProt: P01572
LinkDB
Position
4 C4; 4 42.04 cM
AA seq 189 aa
MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggcggtgctgagctactggccaacctgc
tctctaggatgtgaccttcctcagactcataacctcaggaacaagagagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccgcaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaacatcttcacatcaaaggactcatctgctgcatgg
aatacaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaatttcccctgacccaggaagatgccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaatga

KEGG   Mus musculus (mouse): 15964
Entry
15964             CDS       T01002                                 

Gene name
Ifna11, IFN-[a, IFN-[a]11
Definition
(RefSeq) interferon alpha 11
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15964 (Ifna11)
   04151 PI3K-Akt signaling pathway
    15964 (Ifna11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15964 (Ifna11)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15964 (Ifna11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15964 (Ifna11)
   04621 NOD-like receptor signaling pathway
    15964 (Ifna11)
   04622 RIG-I-like receptor signaling pathway
    15964 (Ifna11)
   04623 Cytosolic DNA-sensing pathway
    15964 (Ifna11)
   04650 Natural killer cell mediated cytotoxicity
    15964 (Ifna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15964 (Ifna11)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15964 (Ifna11)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15964 (Ifna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15964 (Ifna11)
   05161 Hepatitis B
    15964 (Ifna11)
   05160 Hepatitis C
    15964 (Ifna11)
   05171 Coronavirus disease - COVID-19
    15964 (Ifna11)
   05164 Influenza A
    15964 (Ifna11)
   05162 Measles
    15964 (Ifna11)
   05168 Herpes simplex virus 1 infection
    15964 (Ifna11)
   05163 Human cytomegalovirus infection
    15964 (Ifna11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15964 (Ifna11)
   05169 Epstein-Barr virus infection
    15964 (Ifna11)
   05165 Human papillomavirus infection
    15964 (Ifna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15964 (Ifna11)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15964 (Ifna11)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15964
NCBI-ProteinID: NP_032359
MGI: 109210
Ensembl: ENSMUSG00000100549
Vega: OTTMUSG00000011274
UniProt: Q61716
LinkDB
Position
4 C4; 4 42.03 cM
AA seq 190 aa
MARLCAFLMILIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLTPLSCLKDRKDFG
FPLEKVDAQQIQKAQSIPVLRDLTQQILNLFASKDSSAAWNATLLDSFCNDLHQQLNDLQ
GCLMQQVGVQESPLTQEDSLLAVRIYFHRITVFLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEKA
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcttgatagtgatgagctactggtcaacctgt
tctctaggatgcgatctgcctcacacttataacctcaggaacaagagggccttgaaggtc
ctggcacaaatgaggaggctcacccctctttcctgcctaaaggacaggaaggactttgga
ttccccttggagaaggtggatgcccagcagatccagaaggctcaatccatccctgtgctg
cgagatcttacccagcagatcttgaacctcttcgcatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggttgtctgatgcagcaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggatatacttccacaggatcactgtgttcctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaggcttga

KEGG   Mus musculus (mouse): 15965
Entry
15965             CDS       T01002                                 

Gene name
Ifna2, If, Ifa2
Definition
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15965 (Ifna2)
   04151 PI3K-Akt signaling pathway
    15965 (Ifna2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15965 (Ifna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15965 (Ifna2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15965 (Ifna2)
   04621 NOD-like receptor signaling pathway
    15965 (Ifna2)
   04622 RIG-I-like receptor signaling pathway
    15965 (Ifna2)
   04623 Cytosolic DNA-sensing pathway
    15965 (Ifna2)
   04650 Natural killer cell mediated cytotoxicity
    15965 (Ifna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15965 (Ifna2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15965 (Ifna2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15965 (Ifna2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15965 (Ifna2)
   05161 Hepatitis B
    15965 (Ifna2)
   05160 Hepatitis C
    15965 (Ifna2)
   05171 Coronavirus disease - COVID-19
    15965 (Ifna2)
   05164 Influenza A
    15965 (Ifna2)
   05162 Measles
    15965 (Ifna2)
   05168 Herpes simplex virus 1 infection
    15965 (Ifna2)
   05163 Human cytomegalovirus infection
    15965 (Ifna2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15965 (Ifna2)
   05169 Epstein-Barr virus infection
    15965 (Ifna2)
   05165 Human papillomavirus infection
    15965 (Ifna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15965 (Ifna2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15965 (Ifna2)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 15965
NCBI-ProteinID: NP_034633
MGI: 107666
Ensembl: ENSMUSG00000078354
Vega: OTTMUSG00000011279
UniProt: B1AYH7
LinkDB
Position
4 C4; 4 42.02 cM
AA seq 190 aa
MARLCAFLVMLIVMSYWSTCSLGCDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFG
FPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNTTLLDSFCNDLHQQLNDLQ
TCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLPRLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctagactctgtgctttcctcgtgatgctgatagtgatgagctactggtcaacctgt
tctctaggatgcgatctgcctcacacttataacctcaggaacaagagggccttgaaggtc
ctggcacagatgaggaggctcccctttctctcctgcctgaaggacaggcaggactttgga
ttccccctggagaaggtggataaccagcagatccagaaggctcaagccatccctgtgctg
cgagatcttactcagcagaccttgaacctcttcacatcaaaggcttcatctgctgcttgg
aatacaaccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
acctgtctgatgcagcaggtgggggtgcaggaacctcctctgacccaggaagacgccctg
ctggctgtgaggaaatatttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagtcaac
ttgctgccaagactgagtgaagagaaggagtga

KEGG   Mus musculus (mouse): 15967
Entry
15967             CDS       T01002                                 

Gene name
Ifna4, If, Ifa4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15967 (Ifna4)
   04151 PI3K-Akt signaling pathway
    15967 (Ifna4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15967 (Ifna4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15967 (Ifna4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15967 (Ifna4)
   04621 NOD-like receptor signaling pathway
    15967 (Ifna4)
   04622 RIG-I-like receptor signaling pathway
    15967 (Ifna4)
   04623 Cytosolic DNA-sensing pathway
    15967 (Ifna4)
   04650 Natural killer cell mediated cytotoxicity
    15967 (Ifna4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15967 (Ifna4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15967 (Ifna4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15967 (Ifna4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15967 (Ifna4)
   05161 Hepatitis B
    15967 (Ifna4)
   05160 Hepatitis C
    15967 (Ifna4)
   05171 Coronavirus disease - COVID-19
    15967 (Ifna4)
   05164 Influenza A
    15967 (Ifna4)
   05162 Measles
    15967 (Ifna4)
   05168 Herpes simplex virus 1 infection
    15967 (Ifna4)
   05163 Human cytomegalovirus infection
    15967 (Ifna4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15967 (Ifna4)
   05169 Epstein-Barr virus infection
    15967 (Ifna4)
   05165 Human papillomavirus infection
    15967 (Ifna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15967 (Ifna4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15967 (Ifna4)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15967
NCBI-ProteinID: NP_034634
MGI: 107664
Ensembl: ENSMUSG00000070904
Vega: OTTMUSG00000011263
UniProt: P07351 Q540C2
LinkDB
Position
4 C4; 4 42.03 cM
AA seq 186 aa
MARLCAFLMILVMMSYYWSACSLGCDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDF
GFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDL
KACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLAR
LSEEKE
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctcatgatcctggtaatgatgagctactactggtcagcc
tgttctctaggatgtgacctgcctcacacttataacctcgggaacaagagggccttgaca
gtcctggaagaaatgagaagactcccccctctttcctgcctgaaggacaggaaggatttt
ggattccccttggagaaggtggataaccaacagatccagaaggctcaagccatccttgtg
ctaagagatcttacccagcagattttgaacctcttcacatcaaaagacttgtctgctact
tggaatgcaactctactagactcattctgcaatgacctccatcagcagctcaatgacctc
aaagcctgtgtgatgcaggaacctcctctgacccaggaagactccctgctggctgtgagg
acatacttccacaggatcactgtgtacctgagaaagaagaaacacagcctctgtgcctgg
gaggtgatcagagcagaagtctggagagccctctcttcctcaaccaacttgctggcaaga
ctgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 15968
Entry
15968             CDS       T01002                                 

Gene name
Ifna5, If, Ifa5
Definition
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15968 (Ifna5)
   04151 PI3K-Akt signaling pathway
    15968 (Ifna5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15968 (Ifna5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15968 (Ifna5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15968 (Ifna5)
   04621 NOD-like receptor signaling pathway
    15968 (Ifna5)
   04622 RIG-I-like receptor signaling pathway
    15968 (Ifna5)
   04623 Cytosolic DNA-sensing pathway
    15968 (Ifna5)
   04650 Natural killer cell mediated cytotoxicity
    15968 (Ifna5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15968 (Ifna5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15968 (Ifna5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15968 (Ifna5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15968 (Ifna5)
   05161 Hepatitis B
    15968 (Ifna5)
   05160 Hepatitis C
    15968 (Ifna5)
   05171 Coronavirus disease - COVID-19
    15968 (Ifna5)
   05164 Influenza A
    15968 (Ifna5)
   05162 Measles
    15968 (Ifna5)
   05168 Herpes simplex virus 1 infection
    15968 (Ifna5)
   05163 Human cytomegalovirus infection
    15968 (Ifna5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15968 (Ifna5)
   05169 Epstein-Barr virus infection
    15968 (Ifna5)
   05165 Human papillomavirus infection
    15968 (Ifna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15968 (Ifna5)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15968 (Ifna5)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15968
NCBI-ProteinID: NP_034635
MGI: 107663
Ensembl: ENSMUSG00000096682
Vega: OTTMUSG00000011264
UniProt: Q810G2
LinkDB
Structure
PDB: 
3OQ3

Position
4 C4; 4 42.03 cM
AA seq 189 aa
MARLCAFLMVLAVLSYWPTCSLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFG
FPQEKVGAQQIQEAQAIPVLSELTQQVLNIFTSKDSSAAWNATLLDSFCNEVHQQLNDLK
ACVMQQVGVQESPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLARLSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggcggtgctgagctactggccaacctgc
tctctaggatgtgaccttcctcagactcataacctcaggaacaagagagccttaaccctc
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttgga
ttcccacaggagaaggtgggtgcccagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgaagtccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaacaggtcggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagattgagcaaggaggagtga

KEGG   Mus musculus (mouse): 15969
Entry
15969             CDS       T01002                                 

Gene name
Ifna6, IFNa8/6, If, Ifa6, Ifa8, Ifna8
Definition
(RefSeq) interferon alpha 6
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15969 (Ifna6)
   04151 PI3K-Akt signaling pathway
    15969 (Ifna6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15969 (Ifna6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15969 (Ifna6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15969 (Ifna6)
   04621 NOD-like receptor signaling pathway
    15969 (Ifna6)
   04622 RIG-I-like receptor signaling pathway
    15969 (Ifna6)
   04623 Cytosolic DNA-sensing pathway
    15969 (Ifna6)
   04650 Natural killer cell mediated cytotoxicity
    15969 (Ifna6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15969 (Ifna6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15969 (Ifna6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15969 (Ifna6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15969 (Ifna6)
   05161 Hepatitis B
    15969 (Ifna6)
   05160 Hepatitis C
    15969 (Ifna6)
   05171 Coronavirus disease - COVID-19
    15969 (Ifna6)
   05164 Influenza A
    15969 (Ifna6)
   05162 Measles
    15969 (Ifna6)
   05168 Herpes simplex virus 1 infection
    15969 (Ifna6)
   05163 Human cytomegalovirus infection
    15969 (Ifna6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15969 (Ifna6)
   05169 Epstein-Barr virus infection
    15969 (Ifna6)
   05165 Human papillomavirus infection
    15969 (Ifna6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15969 (Ifna6)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15969 (Ifna6)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15969
NCBI-ProteinID: NP_996754
MGI: 107662
Ensembl: ENSMUSG00000101252
Vega: OTTMUSG00000011288
UniProt: Q810G5
LinkDB
Position
4 C4; 4 42.03 cM
AA seq 189 aa
MARLCAFLMVLVVLSYWSTCSLGCDLPQTHNLRNKKALTLLVQMRRLSPLSCLKDRKDFG
FPLEKVDAQQIQEAQAIPVLTELTQQILTLFTSKDSSAAWNATLLDSFCNDLHQQLNDLK
ACVMQEVGVQESPLTQEDSLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEDE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttttggtggtgttgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagaaagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttccccttggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
actgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggacatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagactgagtgaggacgagtga

KEGG   Mus musculus (mouse): 15970
Entry
15970             CDS       T01002                                 

Gene name
Ifna7, If, Ifa7
Definition
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15970 (Ifna7)
   04151 PI3K-Akt signaling pathway
    15970 (Ifna7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15970 (Ifna7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15970 (Ifna7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15970 (Ifna7)
   04621 NOD-like receptor signaling pathway
    15970 (Ifna7)
   04622 RIG-I-like receptor signaling pathway
    15970 (Ifna7)
   04623 Cytosolic DNA-sensing pathway
    15970 (Ifna7)
   04650 Natural killer cell mediated cytotoxicity
    15970 (Ifna7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15970 (Ifna7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15970 (Ifna7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15970 (Ifna7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15970 (Ifna7)
   05161 Hepatitis B
    15970 (Ifna7)
   05160 Hepatitis C
    15970 (Ifna7)
   05171 Coronavirus disease - COVID-19
    15970 (Ifna7)
   05164 Influenza A
    15970 (Ifna7)
   05162 Measles
    15970 (Ifna7)
   05168 Herpes simplex virus 1 infection
    15970 (Ifna7)
   05163 Human cytomegalovirus infection
    15970 (Ifna7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15970 (Ifna7)
   05169 Epstein-Barr virus infection
    15970 (Ifna7)
   05165 Human papillomavirus infection
    15970 (Ifna7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15970 (Ifna7)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15970 (Ifna7)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15970
NCBI-ProteinID: NP_032360
MGI: 107661
Ensembl: ENSMUSG00000100713
Vega: OTTMUSG00000011286
UniProt: Q810G6
LinkDB
Position
4 C4; 4 42.03 cM
AA seq 190 aa
MARLCAFLMVLVVLSYWPTCSLGYDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFR
FPQEKVDAQQIQEAQALCVLHELTQQILNIFTSKDSSAAWDGSLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLTQEDALLAVRTYFHSITVFLREKKHSPCAWEVVRAEVWRALSSSAK
LLARLSEKKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggtcctggtggtgttgagctactggccaacctgc
tctctaggatatgaccttcctcagactcataacctcaggaacaagagagccttaaccctc
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttaga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccctctgtgttctg
catgagctgacccagcagatcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatggatccctcctagactcattctgcaatgacctccaccagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggaacctcctctgacccaggaagatgccctg
ctggctgtgaggacatacttccacagcatcactgtgttcctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagattgagtgagaagaaggagtga

KEGG   Mus musculus (mouse): 15972
Entry
15972             CDS       T01002                                 

Gene name
Ifna9, If, Ifa9
Definition
(RefSeq) interferon alpha 9
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15972 (Ifna9)
   04151 PI3K-Akt signaling pathway
    15972 (Ifna9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15972 (Ifna9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15972 (Ifna9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15972 (Ifna9)
   04621 NOD-like receptor signaling pathway
    15972 (Ifna9)
   04622 RIG-I-like receptor signaling pathway
    15972 (Ifna9)
   04623 Cytosolic DNA-sensing pathway
    15972 (Ifna9)
   04650 Natural killer cell mediated cytotoxicity
    15972 (Ifna9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15972 (Ifna9)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15972 (Ifna9)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15972 (Ifna9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15972 (Ifna9)
   05161 Hepatitis B
    15972 (Ifna9)
   05160 Hepatitis C
    15972 (Ifna9)
   05171 Coronavirus disease - COVID-19
    15972 (Ifna9)
   05164 Influenza A
    15972 (Ifna9)
   05162 Measles
    15972 (Ifna9)
   05168 Herpes simplex virus 1 infection
    15972 (Ifna9)
   05163 Human cytomegalovirus infection
    15972 (Ifna9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15972 (Ifna9)
   05169 Epstein-Barr virus infection
    15972 (Ifna9)
   05165 Human papillomavirus infection
    15972 (Ifna9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15972 (Ifna9)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15972 (Ifna9)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15972
NCBI-ProteinID: NP_034637
MGI: 107659
Ensembl: ENSMUSG00000095270
Vega: OTTMUSG00000007667
UniProt: P09235
LinkDB
Position
4 C4; 4 42.01 cM
AA seq 190 aa
MARPFAFLMVLVVISYWSTCSLGCDLPQTHNLRNKKILTLLAQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLSELTQQILTLFTSKDSSAAWNATLLDSFCTGLHQLLNDLQ
GCLMQLVGMKELPLTQEDSQLAMKKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVN
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggccctttgctttcctgatggtcttggtggtgataagctactggtcaacctgc
tctctaggatgtgacctgcctcaaactcataacctcaggaacaagaaaatcttgacactc
ctggcacaaatgaggagactctcccctctctcttgcctgaaggacagaaaggactttgga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
aatgcaaccctcctagactcattctgcactggcctccaccagctgctcaatgacctgcaa
ggctgtctgatgcagctggtcgggatgaaggaactgcccctgacccaggaagactcccag
ctggctatgaagaaatatttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctcagttaac
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 15974
Entry
15974             CDS       T01002                                 

Gene name
Ifnab
Definition
(RefSeq) interferon alpha B
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15974 (Ifnab)
   04151 PI3K-Akt signaling pathway
    15974 (Ifnab)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15974 (Ifnab)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15974 (Ifnab)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15974 (Ifnab)
   04621 NOD-like receptor signaling pathway
    15974 (Ifnab)
   04622 RIG-I-like receptor signaling pathway
    15974 (Ifnab)
   04623 Cytosolic DNA-sensing pathway
    15974 (Ifnab)
   04650 Natural killer cell mediated cytotoxicity
    15974 (Ifnab)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15974 (Ifnab)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15974 (Ifnab)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    15974 (Ifnab)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15974 (Ifnab)
   05161 Hepatitis B
    15974 (Ifnab)
   05160 Hepatitis C
    15974 (Ifnab)
   05171 Coronavirus disease - COVID-19
    15974 (Ifnab)
   05164 Influenza A
    15974 (Ifnab)
   05162 Measles
    15974 (Ifnab)
   05168 Herpes simplex virus 1 infection
    15974 (Ifnab)
   05163 Human cytomegalovirus infection
    15974 (Ifnab)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15974 (Ifnab)
   05169 Epstein-Barr virus infection
    15974 (Ifnab)
   05165 Human papillomavirus infection
    15974 (Ifnab)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15974 (Ifnab)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15974 (Ifnab)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15974
NCBI-ProteinID: NP_032362
MGI: 1097683
Ensembl: ENSMUSG00000100079
Vega: OTTMUSG00000011271
UniProt: Q61719 L7MTU6
LinkDB
Position
4; 4 C4
AA seq 190 aa
MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLNDLK
TCLMQEVGVQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRALSSSAK
LLASLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctcagcactttcctaatggtcctggcagtgatgagctactggtcaacctgc
cctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgacactc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggacttcgga
ttcccccaggagaaggtggatgcccagcagatccaggaggctcaagccatccctgtcctg
actgagctgacccagcagatgctgaccctcttcacatcaaaggcttcatctgctgcttgg
aatgcaaccctactagactcattctgcaatgacctccaccagcaactcaatgacctgaaa
acctgtctgatgcaggaggtgggggtgcaggaatctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacagcatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaagtggtcagagcagaagtctggagagccctgtcttcctcagccaag
ttgctggcaagtctgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 230396
Entry
230396            CDS       T01002                                 

Gene name
Ifna13
Definition
(RefSeq) interferon alpha 13
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    230396 (Ifna13)
   04151 PI3K-Akt signaling pathway
    230396 (Ifna13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230396 (Ifna13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    230396 (Ifna13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    230396 (Ifna13)
   04621 NOD-like receptor signaling pathway
    230396 (Ifna13)
   04622 RIG-I-like receptor signaling pathway
    230396 (Ifna13)
   04623 Cytosolic DNA-sensing pathway
    230396 (Ifna13)
   04650 Natural killer cell mediated cytotoxicity
    230396 (Ifna13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    230396 (Ifna13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    230396 (Ifna13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    230396 (Ifna13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    230396 (Ifna13)
   05161 Hepatitis B
    230396 (Ifna13)
   05160 Hepatitis C
    230396 (Ifna13)
   05171 Coronavirus disease - COVID-19
    230396 (Ifna13)
   05164 Influenza A
    230396 (Ifna13)
   05162 Measles
    230396 (Ifna13)
   05168 Herpes simplex virus 1 infection
    230396 (Ifna13)
   05163 Human cytomegalovirus infection
    230396 (Ifna13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    230396 (Ifna13)
   05169 Epstein-Barr virus infection
    230396 (Ifna13)
   05165 Human papillomavirus infection
    230396 (Ifna13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    230396 (Ifna13)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   230396 (Ifna13)
SSDB
Motif
Pfam: Interferon RIX1
Other DBs
NCBI-GeneID: 230396
NCBI-ProteinID: NP_796321
MGI: 2667155
Ensembl: ENSMUSG00000063376
Vega: OTTMUSG00000011277
UniProt: Q80SU4
LinkDB
Position
4 C4; 4 42.02 cM
AA seq 189 aa
MARPCAFLMVLVVLSYWSACSLGCDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLK
ACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSAN
LLARLSKEE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggccttgtgctttcctgatggttttggtggtgttgagctactggtcagcctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgactctc
ctggaacaaatgaggagactctcccctctttcctgtctgaaggacagaaaggactttgga
ttcccacaggagaaggtggatgcccagcagatcaagaaggctcaagccatcccttttgtt
catgagctgacccagcagatcctgaccctcttcacatcaaatgactcatctgctgcatgg
aatgcaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcttgtctgatgcagcaggttggggtgcaggaatttcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacagcatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtccagagaaccctgtcttcctcagccaac
ttgctggcaagactgagcaaggaggagtga

KEGG   Mus musculus (mouse): 230398
Entry
230398            CDS       T01002                                 

Gene name
Ifna16, BC114392, Gm13280, Ifn, Ifna6T, Ifnat6
Definition
(RefSeq) interferon alpha 16
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    230398 (Ifna16)
   04151 PI3K-Akt signaling pathway
    230398 (Ifna16)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    230398 (Ifna16)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    230398 (Ifna16)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    230398 (Ifna16)
   04621 NOD-like receptor signaling pathway
    230398 (Ifna16)
   04622 RIG-I-like receptor signaling pathway
    230398 (Ifna16)
   04623 Cytosolic DNA-sensing pathway
    230398 (Ifna16)
   04650 Natural killer cell mediated cytotoxicity
    230398 (Ifna16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    230398 (Ifna16)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    230398 (Ifna16)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    230398 (Ifna16)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    230398 (Ifna16)
   05161 Hepatitis B
    230398 (Ifna16)
   05160 Hepatitis C
    230398 (Ifna16)
   05171 Coronavirus disease - COVID-19
    230398 (Ifna16)
   05164 Influenza A
    230398 (Ifna16)
   05162 Measles
    230398 (Ifna16)
   05168 Herpes simplex virus 1 infection
    230398 (Ifna16)
   05163 Human cytomegalovirus infection
    230398 (Ifna16)
   05167 Kaposi sarcoma-associated herpesvirus infection
    230398 (Ifna16)
   05169 Epstein-Barr virus infection
    230398 (Ifna16)
   05165 Human papillomavirus infection
    230398 (Ifna16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    230398 (Ifna16)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   230398 (Ifna16)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 230398
NCBI-ProteinID: NP_996750
MGI: 3649260
Ensembl: ENSMUSG00000078355
Vega: OTTMUSG00000011275
UniProt: Q810G1
LinkDB
Position
4 C4; 4
AA seq 189 aa
MARLCAFLMVLAVMSYWSTCSLGCDLPQTHKLRNKRALTLLIQMRRLSPLSCLKDRKDFG
FPQEKVDTLKIQKEKAIPVLSEVTQQILNIFTSKDSSAAWDATLLDTFCNDLYQQLNDLQ
ACLVQQVRLQEPPLTQEVSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSAN
VLGRLREEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatggttctggctgtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataaactcaggaacaagagagccttgacactc
ttgatacaaatgaggagactctcccctctctcctgcctgaaggacaggaaggactttgga
ttcccccaggagaaggtggataccctgaagatccagaaagagaaagccatccctgtccta
agtgaggtgacccagcagatcctgaacatcttcacatcaaaggattcatctgctgcttgg
gatgcaaccctcctagatacattttgtaatgacctctaccagcagctcaatgacctgcaa
gcctgtctagtgcagcaggtgaggttgcaggaacctcctctgacccaggaagtctccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccctgtcttcctctgccaat
gtgctgggaagactgagagaagagaaatga

KEGG   Mus musculus (mouse): 242517
Entry
242517            CDS       T01002                                 

Gene name
Ifna15, Gm12597, I, Ifnaa, MuIFN-alpha-A
Definition
(RefSeq) interferon alpha 15
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    242517 (Ifna15)
   04151 PI3K-Akt signaling pathway
    242517 (Ifna15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    242517 (Ifna15)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    242517 (Ifna15)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    242517 (Ifna15)
   04621 NOD-like receptor signaling pathway
    242517 (Ifna15)
   04622 RIG-I-like receptor signaling pathway
    242517 (Ifna15)
   04623 Cytosolic DNA-sensing pathway
    242517 (Ifna15)
   04650 Natural killer cell mediated cytotoxicity
    242517 (Ifna15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    242517 (Ifna15)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    242517 (Ifna15)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    242517 (Ifna15)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    242517 (Ifna15)
   05161 Hepatitis B
    242517 (Ifna15)
   05160 Hepatitis C
    242517 (Ifna15)
   05171 Coronavirus disease - COVID-19
    242517 (Ifna15)
   05164 Influenza A
    242517 (Ifna15)
   05162 Measles
    242517 (Ifna15)
   05168 Herpes simplex virus 1 infection
    242517 (Ifna15)
   05163 Human cytomegalovirus infection
    242517 (Ifna15)
   05167 Kaposi sarcoma-associated herpesvirus infection
    242517 (Ifna15)
   05169 Epstein-Barr virus infection
    242517 (Ifna15)
   05165 Human papillomavirus infection
    242517 (Ifna15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    242517 (Ifna15)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   242517 (Ifna15)
SSDB
Motif
Pfam: Interferon APC1_C DUF4569
Other DBs
NCBI-GeneID: 242517
NCBI-ProteinID: NP_996753
MGI: 3649418
Ensembl: ENSMUSG00000096011
Vega: OTTMUSG00000007655
UniProt: Q61718
LinkDB
Position
4; 4 C4
AA seq 190 aa
MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFR
FPQEKVDAQQIQNAQAIPVLQELTQQVLNIFTSKDSSAAWDASLLDSFCNDLHQQLNDLK
ACVMQEVGVQEPPLTQEDYLLAVRTYFHRITVYLREKKHSPCAWEVVRAEVWRAMSSSAK
LLARLSEEKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctagtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgaccctc
ctggtacaaatgaggagactctcccctctctcctgcctgaaggacagaaaggactttaga
ttcccccaggagaaggtggatgcccagcagatccagaatgctcaagccatccctgtccta
caagagctgacccagcaggtcctgaacatcttcacatcaaaggactcatctgctgcttgg
gatgcatccctcctagactcattctgcaatgacctccatcagcagctcaatgacctcaaa
gcctgtgtgatgcaggaggtgggggtgcaggaacctcccctgacccaggaagactacctg
ctggctgtgaggacatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagagccatgtcttcctcagccaag
ttgctggcaagactgagtgaggagaaggagtga

KEGG   Mus musculus (mouse): 242519
Entry
242519            CDS       T01002                                 

Gene name
Ifna12
Definition
(RefSeq) interferon alpha 12
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    242519 (Ifna12)
   04151 PI3K-Akt signaling pathway
    242519 (Ifna12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    242519 (Ifna12)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    242519 (Ifna12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    242519 (Ifna12)
   04621 NOD-like receptor signaling pathway
    242519 (Ifna12)
   04622 RIG-I-like receptor signaling pathway
    242519 (Ifna12)
   04623 Cytosolic DNA-sensing pathway
    242519 (Ifna12)
   04650 Natural killer cell mediated cytotoxicity
    242519 (Ifna12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    242519 (Ifna12)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    242519 (Ifna12)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    242519 (Ifna12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    242519 (Ifna12)
   05161 Hepatitis B
    242519 (Ifna12)
   05160 Hepatitis C
    242519 (Ifna12)
   05171 Coronavirus disease - COVID-19
    242519 (Ifna12)
   05164 Influenza A
    242519 (Ifna12)
   05162 Measles
    242519 (Ifna12)
   05168 Herpes simplex virus 1 infection
    242519 (Ifna12)
   05163 Human cytomegalovirus infection
    242519 (Ifna12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    242519 (Ifna12)
   05169 Epstein-Barr virus infection
    242519 (Ifna12)
   05165 Human papillomavirus infection
    242519 (Ifna12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    242519 (Ifna12)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   242519 (Ifna12)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 242519
NCBI-ProteinID: NP_796335
MGI: 2676324
Ensembl: ENSMUSG00000073811
Vega: OTTMUSG00000007663
UniProt: Q80SS5
LinkDB
Position
4; 4 C4
AA seq 189 aa
MARLCAFLMTLLVMSYWSTCSLGCDLPQTHNLRNKRALTLLAQMRRLSPLSCLKDRKNFR
FPQEKVDAQQIKKAQVIPVLSELTQQILTLFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQ
GCLMQQVGVQEPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRTLSSSAK
LLARLSEKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctagtgatgagctactggtcaacctgc
tctctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgactctc
ctggcacaaatgaggagactctcccctctctcctgcctgaaggacagaaagaactttaga
ttcccccaggagaaggtggatgcccagcagatcaagaaggctcaagtcatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcatgg
aatacaaccctcctagactcattctgcaatgacctccatcagcagctcaatgacctgcaa
ggctgtctgatgcagcaggtgggggtgcaggagcctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtgtacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaagtctggagaaccctgtcttcctcagctaag
ttgctggcaagactgagtgagaaggagtga

KEGG   Mus musculus (mouse): 404549
Entry
404549            CDS       T01002                                 

Gene name
Ifna14
Definition
(RefSeq) interferon alpha 14
  KO
K05414  interferon alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    404549 (Ifna14)
   04151 PI3K-Akt signaling pathway
    404549 (Ifna14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404549 (Ifna14)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    404549 (Ifna14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    404549 (Ifna14)
   04621 NOD-like receptor signaling pathway
    404549 (Ifna14)
   04622 RIG-I-like receptor signaling pathway
    404549 (Ifna14)
   04623 Cytosolic DNA-sensing pathway
    404549 (Ifna14)
   04650 Natural killer cell mediated cytotoxicity
    404549 (Ifna14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    404549 (Ifna14)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    404549 (Ifna14)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    404549 (Ifna14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    404549 (Ifna14)
   05161 Hepatitis B
    404549 (Ifna14)
   05160 Hepatitis C
    404549 (Ifna14)
   05171 Coronavirus disease - COVID-19
    404549 (Ifna14)
   05164 Influenza A
    404549 (Ifna14)
   05162 Measles
    404549 (Ifna14)
   05168 Herpes simplex virus 1 infection
    404549 (Ifna14)
   05163 Human cytomegalovirus infection
    404549 (Ifna14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    404549 (Ifna14)
   05169 Epstein-Barr virus infection
    404549 (Ifna14)
   05165 Human papillomavirus infection
    404549 (Ifna14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    404549 (Ifna14)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   404549 (Ifna14)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 404549
NCBI-ProteinID: NP_996858
MGI: 3641425
Ensembl: ENSMUSG00000095896
Vega: OTTMUSG00000007662
UniProt: Q810G3
LinkDB
Position
4; 4 C4
AA seq 189 aa
MARLCAFLMTLLVMSYWSTCCLGCDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFG
FPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCNDLNTQLNDLQ
GCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEIWRALSSSAK
LLTSLKEEK
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctaggctctgtgctttcctgatgaccctgctggtgatgagctactggtcaacctgc
tgtctaggatgtgacctgcctcagactcataacctcaggaacaagagagccttgacactt
ctggtaaaaatgaggagactctcccctctctcctgcctgaaggaccggaaggactttgga
ttcccgcaggagaaggtggatgcccagcagatcaagaaggctcaagccatccctgtcctg
agtgagctgacccagcagatcctgaccctcttcacatcaaaggactcatctgctgcttgg
gatgcaaccctcctagactccttctgcaatgacctcaacactcagctcaatgacctgcaa
ggctgtctgatgcagcaggtagagatacaggcacctcccctgacccaggaagactccctg
ctggctgtgaggaaatacttccacaggatcactgtttacctgagagagaagaaacacagc
ccctgtgcctgggaggtggtcagagcagaaatctggagagccctgtcttcctcagccaag
ttgctgaccagcctgaaagaagagaagtga

DBGET integrated database retrieval system