KEGG   Mus musculus (mouse): 15977
Entry
15977             CDS       T01002                                 

Gene name
Ifnb1, IFN-b, IFN-beta, IFNB, If, Ifb
Definition
(RefSeq) interferon beta 1, fibroblast
  KO
K05415  interferon beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04630  JAK-STAT signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04668  TNF signaling pathway
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    15977 (Ifnb1)
   04668 TNF signaling pathway
    15977 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    15977 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    15977 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    15977 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    15977 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    15977 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    15977 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    15977 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    15977 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    15977 (Ifnb1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    15977 (Ifnb1)
   05152 Tuberculosis
    15977 (Ifnb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    15977 (Ifnb1)
   05161 Hepatitis B
    15977 (Ifnb1)
   05160 Hepatitis C
    15977 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    15977 (Ifnb1)
   05164 Influenza A
    15977 (Ifnb1)
   05162 Measles
    15977 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    15977 (Ifnb1)
   05163 Human cytomegalovirus infection
    15977 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15977 (Ifnb1)
   05169 Epstein-Barr virus infection
    15977 (Ifnb1)
   05165 Human papillomavirus infection
    15977 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    15977 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15977 (Ifnb1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interferons
   15977 (Ifnb1)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 15977
NCBI-ProteinID: NP_034640
MGI: 107657
Ensembl: ENSMUSG00000048806
Vega: OTTMUSG00000007654
UniProt: P01575 Q0VE17
LinkDB
Structure
PDB: 
1WU3 1IFA 3WCY

Position
4 C4; 4 41.91 cM
AA seq 182 aa
MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIP
MEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLE
EKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNF
QN
NT seq 549 nt   +upstreamnt  +downstreamnt
atgaacaacaggtggatcctccacgctgcgttcctgctgtgcttctccaccacagccctc
tccatcaactataagcagctccagctccaagaaaggacgaacattcggaaatgtcaggag
ctcctggagcagctgaatggaaagatcaacctcacctacagggcggacttcaagatccct
atggagatgacggagaagatgcagaagagttacactgcctttgccatccaagagatgctc
cagaatgtctttcttgtcttcagaaacaatttctccagcactgggtggaatgagactatt
gttgtacgtctcctggatgaactccaccagcagacagtgtttctgaagacagtactagag
gaaaagcaagaggaaagattgacgtgggagatgtcctcaactgctctccacttgaagagc
tattactggagggtgcaaaggtaccttaaactcatgaagtacaacagctacgcctggatg
gtggtccgagcagagatcttcaggaactttctcatcattcgaagacttaccagaaacttc
caaaactga

DBGET integrated database retrieval system