KEGG   Mus musculus (mouse): 16000Help
Entry
16000             CDS       T01002                                 

Gene name
Igf1, C730016P09Rik, Igf-1, Igf-I
Definition
(RefSeq) insulin-like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16000 (Igf1)
   04015 Rap1 signaling pathway
    16000 (Igf1)
   04010 MAPK signaling pathway
    16000 (Igf1)
   04066 HIF-1 signaling pathway
    16000 (Igf1)
   04068 FoxO signaling pathway
    16000 (Igf1)
   04151 PI3K-Akt signaling pathway
    16000 (Igf1)
   04152 AMPK signaling pathway
    16000 (Igf1)
   04150 mTOR signaling pathway
    16000 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    16000 (Igf1)
   04115 p53 signaling pathway
    16000 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16000 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    16000 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16000 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    16000 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16000 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    16000 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16000 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    16000 (Igf1)
   04213 Longevity regulating pathway - multiple species
    16000 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16000 (Igf1)
   05202 Transcriptional misregulation in cancer
    16000 (Igf1)
   05205 Proteoglycans in cancer
    16000 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    16000 (Igf1)
   05218 Melanoma
    16000 (Igf1)
   05215 Prostate cancer
    16000 (Igf1)
   05224 Breast cancer
    16000 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16000 (Igf1)
   05414 Dilated cardiomyopathy (DCM)
    16000 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16000 (Igf1)
   01522 Endocrine resistance
    16000 (Igf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16000 (Igf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin
Motif
Other DBs
NCBI-GeneID: 16000
NCBI-ProteinID: NP_001104745
MGI: 96432
Ensembl: ENSMUSG00000020053
Vega: OTTMUSG00000031391
UniProt: P05017 Q4VJC0
LinkDB All DBs
Position
10 C1; 10 43.7 cM
AA seq 153 aa AA seqDB search
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc
accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat
gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt
gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct
atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

KEGG   Mus musculus (mouse): 16002Help
Entry
16002             CDS       T01002                                 

Gene name
Igf2, AL033362, Igf-2, Igf-II, M6pr, Mpr, Peg2
Definition
(RefSeq) insulin-like growth factor 2
  KO
K13769  insulin-like growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16002 (Igf2)
   04010 MAPK signaling pathway
    16002 (Igf2)
   04151 PI3K-Akt signaling pathway
    16002 (Igf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16002 (Igf2)
   05205 Proteoglycans in cancer
    16002 (Igf2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16002 (Igf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16002 (Igf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   16002 (Igf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGF2_C Insulin DUF1979
Motif
Other DBs
NCBI-GeneID: 16002
NCBI-ProteinID: NP_001116208
MGI: 96434
Ensembl: ENSMUSG00000048583
Vega: OTTMUSG00000035324
UniProt: P09535
LinkDB All DBs
Position
7 F5; 7 87.99 cM
AA seq 180 aa AA seqDB search
MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRAN
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFQYDTWR
QSAGRLRRGLPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggggatcccagtggggaagtcgatgttggtgcttctcatctctttggccttcgccttg
tgctgcatcgctgcttacggccccggagagactctgtgcggaggggagcttgttgacacg
cttcagtttgtctgttcggaccgcggcttctacttcagcaggccttcaagccgtgccaac
cgtcgcagccgtggcatcgtggaagagtgctgcttccgcagctgcgacctggccctcctg
gagacatactgtgccacccccgccaagtccgagagggacgtgtctacctctcaggccgta
cttccggacgacttccccagataccccgtgggcaagttcttccaatatgacacctggaga
cagtccgcgggacgcctgcgcagaggcctgcctgccctcctgcgtgcccgccggggtcgc
atgcttgccaaagagctcaaagagttcagagaggccaaacgtcatcgtcccctgatcgtg
ttaccacccaaagaccccgcccacgggggagcctcttcggagatgtccagcaaccatcag
tga

DBGET integrated database retrieval system