KEGG   Mus musculus (mouse): 16150Help
Entry
16150             CDS       T01002                                 

Gene name
Ikbkb, AI132552, IKK-2, IKK-beta, IKK2, IKK[b], IKKbeta
Definition
(RefSeq) inhibitor of kappaB kinase beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04068  FoxO signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05215  Prostate cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16150 (Ikbkb)
   04010 MAPK signaling pathway
    16150 (Ikbkb)
   04064 NF-kappa B signaling pathway
    16150 (Ikbkb)
   04668 TNF signaling pathway
    16150 (Ikbkb)
   04068 FoxO signaling pathway
    16150 (Ikbkb)
   04151 PI3K-Akt signaling pathway
    16150 (Ikbkb)
   04150 mTOR signaling pathway
    16150 (Ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16150 (Ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16150 (Ikbkb)
   04621 NOD-like receptor signaling pathway
    16150 (Ikbkb)
   04622 RIG-I-like receptor signaling pathway
    16150 (Ikbkb)
   04623 Cytosolic DNA-sensing pathway
    16150 (Ikbkb)
   04625 C-type lectin receptor signaling pathway
    16150 (Ikbkb)
   04660 T cell receptor signaling pathway
    16150 (Ikbkb)
   04658 Th1 and Th2 cell differentiation
    16150 (Ikbkb)
   04659 Th17 cell differentiation
    16150 (Ikbkb)
   04657 IL-17 signaling pathway
    16150 (Ikbkb)
   04662 B cell receptor signaling pathway
    16150 (Ikbkb)
   04062 Chemokine signaling pathway
    16150 (Ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    16150 (Ikbkb)
   04920 Adipocytokine signaling pathway
    16150 (Ikbkb)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16150 (Ikbkb)
  09158 Development
   04380 Osteoclast differentiation
    16150 (Ikbkb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16150 (Ikbkb)
   05206 MicroRNAs in cancer
    16150 (Ikbkb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16150 (Ikbkb)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    16150 (Ikbkb)
   05221 Acute myeloid leukemia
    16150 (Ikbkb)
   05220 Chronic myeloid leukemia
    16150 (Ikbkb)
   05215 Prostate cancer
    16150 (Ikbkb)
   05222 Small cell lung cancer
    16150 (Ikbkb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16150 (Ikbkb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16150 (Ikbkb)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16150 (Ikbkb)
   04931 Insulin resistance
    16150 (Ikbkb)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16150 (Ikbkb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16150 (Ikbkb)
   05170 Human immunodeficiency virus 1 infection
    16150 (Ikbkb)
   05162 Measles
    16150 (Ikbkb)
   05164 Influenza A
    16150 (Ikbkb)
   05161 Hepatitis B
    16150 (Ikbkb)
   05160 Hepatitis C
    16150 (Ikbkb)
   05168 Herpes simplex virus 1 infection
    16150 (Ikbkb)
   05163 Human cytomegalovirus infection
    16150 (Ikbkb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16150 (Ikbkb)
   05169 Epstein-Barr virus infection
    16150 (Ikbkb)
   05165 Human papillomavirus infection
    16150 (Ikbkb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16150 (Ikbkb)
   05142 Chagas disease (American trypanosomiasis)
    16150 (Ikbkb)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    16150 (Ikbkb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16150 (Ikbkb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     16150 (Ikbkb)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   16150 (Ikbkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IKBKB_SDD Pkinase Pkinase_Tyr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Glyco_hydro_65m Med20
Motif
Other DBs
NCBI-GeneID: 16150
NCBI-ProteinID: NP_034676
MGI: 1338071
Ensembl: ENSMUSG00000031537
Vega: OTTMUSG00000020581
UniProt: O88351 Q5D0E0 A0A0R4J0T4
LinkDB All DBs
Position
8; 8 A2
AA seq 738 aa AA seqDB search
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQATGEQIAIKQCRQELSPKNRDRWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREG
AVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGAVKFSSSLPFPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPQYGPNGCF
RALDDILNLKLVHVLNMVTGTVHTYPVTEDESLQSLKTRIQEDTGILETDQELLQEAGLV
LLPDKPATQCISDSKTNEGLTLDMDLVFLFDNSKINYETQITPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMSLLRNNSCLSKMKNAMASTAQQLK
AKLDFFKTSIQIDLEKYKEQTEFGITSDKLLLAWREMEQAVEQCGRENDVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKSEELVAEAHALCSRLE
SALQDTVKEQDRSFTVTA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcaccgtccctcccaacccagacatgtggagcctgggaaatgaaagaacgc
ctggggaccgggggatttggaaacgtcatccggtggcacaatcaggcgacaggtgaacag
atcgccatcaagcaatgccgacaggagctcagcccaaagaacagagaccgctggtgcctc
gaaatccagatcatgagaaggctgaaccatcccaatgtggtggctgcccgggatgtccca
gaggggatgcagaacctggcacccaatgatttgccactgctggccatggagtactgccaa
ggaggagatctccgaagatacttgaaccagttcgagaactgctgtggcctgcgggaagga
gctgtccttaccctgctgagtgacatcgcatcggctcttagataccttcacgaaaacaga
atcatccatcgagacctgaagccagaaaacatcgttctgcagcaaggagagaaaagatta
atacacaaaattattgatctaggatatgccaaggagctggatcagggcagtctgtgcacg
tcatttgtggggactctgcaatacctggcgccagagcttctggagcagcagaagtacacc
gtgaccgttgactactggagcttcggcaccctggccttcgagtgcatcactggcttccgg
cccttcctccctaactggcagcctgtgcagtggcactccaaagtccggcagaagagcgaa
gtggacatcgttgttagtgaagacttgaatggagcagtgaagttttcaagttcgctaccc
ttccccaataatcttaacagtgtcttggctgaacggctggagaagtggctgcagctgatg
cttatgtggcaccctcggcaaaggggcacggatccccagtatggccccaacggctgcttc
agagccctggatgacatcttgaacttgaagctggttcatgtcttgaacatggtcacaggc
accgttcacacataccccgtgacggaggatgagagtctgcagagcttaaaaaccagaatc
caggaagacacggggatcctggagacagaccaggagctgctgcaagaggcagggctggtg
ctgctccctgacaagcctgctactcagtgcatctcagacagcaagacaaacgagggcctc
acgttggacatggatcttgtttttctctttgacaacagtaaaatcaactatgagactcag
atcaccccccgaccccaaccggaaagtgtcagctgtatccttcaggagcccaagcggaac
ctctccttcttccagctgaggaaagtgtggggccaagtctggcacagcatccagacgctg
aaggaagactgtaaccggctgcagcagggacagcgagcagccatgatgagtctcctccgg
aataacagctgcctctctaagatgaagaacgccatggcctccacggcccagcagctcaag
gccaagctggacttcttcaaaaccagcatccagatcgacctggagaagtataaagagcag
accgagtttgggatcacctcagataaattgctgctggcttggcgggagatggagcaggct
gtggagcagtgtgggcgggagaatgacgtgaagcatctagtagagcggatgatggcactg
cagactgacattgtggacctgcagaggagcccgatgggtcggaagcaggggggcaccctg
gatgacctagaggaacaagcgagggagctctaccgaagactcagggagaagccaagagac
caaaggacagaaggtgacagccaggagatggtacggctgctgcttcaggcaatccaaagc
tttgagaagaaagttcgggtgatttatacacagctcagtaagaccgtggtttgtaagcag
aaggcactggagttgctgcccaaggtagaagaggtagtgagccttatgaacgaggacgag
aggaccgtggtccggcttcaggagaagcggcagaaggaactctggaacctcctgaagatc
gcctgtagcaaagtccgaggtcccgtgagtggaagcccagacagcatgaatgtgtctcga
ctcagtcaccctggtcagctaatgtcccagccttccagtgcctgtgacagcttacctgaa
tcagacaagaaaagtgaagaactggtggccgaagcccacgccctctgctcccggctagaa
agtgcgctgcaggacactgtgaaggagcaagacagaagcttcacggtaaccgcctga

DBGET integrated database retrieval system