KEGG   Mus musculus (mouse): 16176Help
Entry
16176             CDS       T01002                                 

Gene name
Il1b, IL-1beta, Il-1b
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04668  TNF signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04940  Type I diabetes mellitus
mmu05010  Alzheimer disease
mmu05020  Prion diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05332  Graft-versus-host disease
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16176 (Il1b)
   04064 NF-kappa B signaling pathway
    16176 (Il1b)
   04668 TNF signaling pathway
    16176 (Il1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16176 (Il1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16176 (Il1b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16176 (Il1b)
   04620 Toll-like receptor signaling pathway
    16176 (Il1b)
   04621 NOD-like receptor signaling pathway
    16176 (Il1b)
   04623 Cytosolic DNA-sensing pathway
    16176 (Il1b)
   04625 C-type lectin receptor signaling pathway
    16176 (Il1b)
   04659 Th17 cell differentiation
    16176 (Il1b)
   04657 IL-17 signaling pathway
    16176 (Il1b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16176 (Il1b)
  09158 Development
   04380 Osteoclast differentiation
    16176 (Il1b)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    16176 (Il1b)
   05321 Inflammatory bowel disease (IBD)
    16176 (Il1b)
   05332 Graft-versus-host disease
    16176 (Il1b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16176 (Il1b)
   05020 Prion diseases
    16176 (Il1b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16176 (Il1b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16176 (Il1b)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16176 (Il1b)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16176 (Il1b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16176 (Il1b)
   05135 Yersinia infection
    16176 (Il1b)
   05133 Pertussis
    16176 (Il1b)
   05134 Legionellosis
    16176 (Il1b)
   05152 Tuberculosis
    16176 (Il1b)
  09172 Infectious disease: viral
   05162 Measles
    16176 (Il1b)
   05164 Influenza A
    16176 (Il1b)
   05168 Herpes simplex virus 1 infection
    16176 (Il1b)
   05163 Human cytomegalovirus infection
    16176 (Il1b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16176 (Il1b)
   05144 Malaria
    16176 (Il1b)
   05140 Leishmaniasis
    16176 (Il1b)
   05142 Chagas disease (American trypanosomiasis)
    16176 (Il1b)
   05143 African trypanosomiasis
    16176 (Il1b)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    16176 (Il1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16176 (Il1b)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16176 (Il1b)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16176 (Il1b)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Cytokines
   16176 (Il1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep Inhibitor_I71
Motif
Other DBs
NCBI-GeneID: 16176
NCBI-ProteinID: NP_032387
MGI: 96543
Ensembl: ENSMUSG00000027398
Vega: OTTMUSG00000015509
UniProt: P10749
LinkDB All DBs
Structure
PDB: 

Position
2 F1; 2 62.97 cM
AA seq 269 aa AA seqDB search
MATVPELNCEMPPFDSDENDLFFEVDGPQKMKGCFQTFDLGCPDESIQLQISQQHINKSF
RQAVSLIVAVEKLWQLPVSFPWTFQDEDMSTFFSFIFEEEPILCDSWDDDDNLLVCDVPI
RQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLK
GKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYIS
TSQAEHKPVFLGNNSGQDIIDFTMESVSS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgttcctgaactcaactgtgaaatgccaccttttgacagtgatgagaatgac
ctgttctttgaagttgacggaccccaaaagatgaagggctgcttccaaacctttgacctg
ggctgtcctgatgagagcatccagcttcaaatctcgcagcagcacatcaacaagagcttc
aggcaggcagtatcactcattgtggctgtggagaagctgtggcagctacctgtgtctttc
ccgtggaccttccaggatgaggacatgagcaccttcttttccttcatctttgaagaagag
cccatcctctgtgactcatgggatgatgatgataacctgctggtgtgtgacgttcccatt
agacaactgcactacaggctccgagatgaacaacaaaaaagcctcgtgctgtcggaccca
tatgagctgaaagctctccacctcaatggacagaatatcaaccaacaagtgatattctcc
atgagctttgtacaaggagaaccaagcaacgacaaaatacctgtggccttgggcctcaaa
ggaaagaatctatacctgtcctgtgtaatgaaagacggcacacccaccctgcagctggag
agtgtggatcccaagcaatacccaaagaagaagatggaaaaacggtttgtcttcaacaag
atagaagtcaagagcaaagtggagtttgagtctgcagagttccccaactggtacatcagc
acctcacaagcagagcacaagcctgtcttcctgggaaacaacagtggtcaggacataatt
gacttcaccatggaatccgtgtcttcctaa

DBGET integrated database retrieval system