KEGG   Mus musculus (mouse): 16177Help
Entry
16177             CDS       T01002                                 

Gene name
Il1r1, CD121a, CD121b, IL-1R1, IL-iR, Il1r-1
Definition
(RefSeq) interleukin 1 receptor, type I
  KO
K04386  interleukin 1 receptor type I
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04659  Th17 cell differentiation
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16177 (Il1r1)
   04064 NF-kappa B signaling pathway
    16177 (Il1r1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16177 (Il1r1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16177 (Il1r1)
   04659 Th17 cell differentiation
    16177 (Il1r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16177 (Il1r1)
  09158 Development
   04380 Osteoclast differentiation
    16177 (Il1r1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16177 (Il1r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16177 (Il1r1)
   05163 Human cytomegalovirus infection
    16177 (Il1r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16177 (Il1r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16177 (Il1r1)
   04090 CD molecules [BR:mmu04090]
    16177 (Il1r1)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL1 receptor family
   16177 (Il1r1)
CD molecules [BR:mmu04090]
 Proteins
  16177 (Il1r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_2 Ig_3 Ig_6 I-set ig Ig_5 V-set
Motif
Other DBs
NCBI-GeneID: 16177
NCBI-ProteinID: NP_032388
MGI: 96545
Ensembl: ENSMUSG00000026072
Vega: OTTMUSG00000050518
UniProt: P13504 Q32MH0
LinkDB All DBs
Position
1 B; 1 18.81 cM
AA seq 576 aa AA seqDB search
MENMKVLLGLICLMVPLLSLEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIW
YKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLEND
PGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGV
KDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIE
ADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLN
ISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKNYLIGGFIILTATIVCCVCIYK
VFKVDIVLWYRDSCSGFLPSKASDGKTYDAYILYPKTLGEGSFSDLDTFVFKLLPEVLEG
QFGYKLFIYGRDDYVGEDTIEVTNENVKKSRRLIIILVRDMGGFSWLGQSSEEQIAIYNA
LIQEGIKIVLLELEKIQDYEKMPDSIQFIKQKHGVICWSGDFQERPQSAKTRFWKNLRYQ
MPAQRRSPLSKHRLLTLDPVRDTKEKLPAATHLPLG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggagaatatgaaagtgctactggggctcatttgtctcatggtgcctctgctgtcgctg
gagattgacgtatgtacagaatatccaaatcagatcgttttgtttttatctgtaaatgaa
attgatattcgcaagtgtcctcttactccaaataaaatgcacggcgacaccataatttgg
tacaagaatgacagcaagacccccatatcagcggaccgggactccaggattcatcagcag
aatgaacatctttggtttgtacctgccaaggtggaggactcaggatattactattgtata
gtaagaaactcaacttactgcctcaaaactaaagtaaccgtaactgtgttagagaatgac
cctggcttgtgttacagcacacaggccaccttcccacagcggctccacattgccggggat
ggaagtcttgtgtgcccttatgtgagttattttaaagatgaaaataatgagttacccgag
gtccagtggtataagaactgtaaacctctgcttcttgacaacgtgagcttcttcggagta
aaagataaactgttggtgaggaatgtggctgaagagcacagaggggactatatatgccgt
atgtcctatacgttccgggggaagcaatatccggtcacacgagtaatacaatttatcaca
atagatgaaaacaagagggacagacctgttatcctgagccctcggaatgagacgatcgaa
gctgacccaggatcaatgatacaactgatctgcaacgtcacgggccagttctcagacctt
gtctactggaagtggaatggatcagaaattgaatggaatgatccatttctagctgaagac
tatcaatttgtggaacatccttcaaccaaaagaaaatacacactcattacaacacttaac
atttcagaagttaaaagccagttttatcgctatccgtttatctgtgttgttaagaacaca
aatatttttgagtcggcgcatgtgcagttaatatacccagtccctgacttcaagaattac
ctcatcgggggctttatcatcctcacggctacaattgtatgctgtgtgtgcatctataaa
gtcttcaaggttgacatagtgctttggtacagggactcctgctctggttttcttccttca
aaagcttcagatggaaagacatacgatgcctatattctttatcccaagaccctgggagag
gggtccttctcagacttagatacttttgtttttaaactgttgcctgaggtcttggaggga
cagtttggatacaagctgttcatttatggaagggatgactatgttggagaagataccatc
gaggttactaatgaaaatgtaaagaaaagcaggaggctgattatcattctagtgagagat
atgggaggcttcagctggctgggccagtcatctgaagagcaaatagccatatacaatgct
ctcatccaggaaggaattaaaatcgtcctgcttgagttggagaaaatccaagactatgag
aaaatgccagattctattcagttcattaagcagaaacacggagtcatttgctggtcagga
gactttcaagaaagaccacagtctgcaaagaccaggttctggaaaaacttaagataccag
atgccagcccaacggagatcaccattgtctaaacaccgcttactaaccctggatcctgtg
cgggacactaaggagaaactgccggcagcaacacacttaccactcggctag

DBGET integrated database retrieval system