KEGG   Mus musculus (mouse): 16188
Entry
16188             CDS       T01002                                 

Gene name
Il3ra, CD123, CDw123, SUT-, SUT-1
Definition
(RefSeq) interleukin 3 receptor, alpha chain
  KO
K04737  interleukin 3 receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16188 (Il3ra)
   04151 PI3K-Akt signaling pathway
    16188 (Il3ra)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16188 (Il3ra)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    16188 (Il3ra)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16188 (Il3ra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16188 (Il3ra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16188 (Il3ra)
   04090 CD molecules [BR:mmu04090]
    16188 (Il3ra)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL3 receptor family
   16188 (Il3ra)
CD molecules [BR:mmu04090]
 Proteins
  16188 (Il3ra)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 16188
NCBI-ProteinID: NP_032395
MGI: 96553
Ensembl: ENSMUSG00000068758
UniProt: P26952
LinkDB
Position
14 A1; 14 7.08 cM
AA seq 396 aa
MAANLWLILGLLASHSSDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGA
FCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAA
QDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAP
HGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPT
LTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFR
VKSRSEVYPRKLSSWSEAWGLVCPPEVMPVKTALVTSVATVLGAGLVAAGLLLWWRKSLL
YRLCPPIPRLRLPLAGEMVVWEPALEDCEVTPVTDA
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggccgccaacctgtggctcatcctggggctcctggcatcccactcttcagatctggct
gcggtccgtgaggctccacccactgctgtgaccacgcccatccagaacctgcatatcgac
cccgcccactacacactgagctgggaccccgcccccggcgctgacatcacgacaggggct
ttttgcaggaagggcagggacatctttgtctgggctgaccccgggcttgcccgctgctca
ttccagtcgctctccctctgccatgtgaccaacttcaccgtcttcctggggaaggacagg
gctgtggcaggatccatccagttccccccagatgatgatggcgaccacgaggccgcagcc
caggacctgcgctgctgggtgcatgaggggcagctgagctgccaatgggagcggggtccg
aaagcaacgggtgacgtgcactaccggatgttctggcgtgatgtgcggctcggtcctgcc
cacaaccgcgagtgtccacactaccacagccttgatgtcaacaccgctggccccgcccct
catggtggccatgaaggctgcacccttgacctcgacactgtccttggctccacccccaac
agccctgaccttgtcccccaggtcaccatcaccgtcaacggcagtggccgcgctggcccc
gtgccctgcatggacaacactgtggacctgcagcgcgcagaggtcctggccccgcccacg
ttgacagtggagtgcaacggctctgaggcccatgcccgatgggtcgcgcggaacagattc
caccatggcctccttgggtacaccctgcaggtcaaccagagctcccgctcagagccacag
gaatacaatgtctccatcccccacttctgggtccccaacgctggtgccatctccttccgg
gtcaagtcgaggtcagaggtttaccctcggaagctcagcagctggagcgaagcctggggc
ctcgtctgccccccagaggtgatgcctgtgaagacagccttggtgacttcagtggctacg
gtgctgggggcagggctcgtggcagctgggctcctgctgtggtggaggaagtcgctgctc
taccgcctgtgcccacccattccacgcctgcgcctgcccttggcaggggagatggtcgtg
tgggaaccagctcttgaagactgcgaggtgacgcctgtgacagacgcctga

DBGET integrated database retrieval system