KEGG   Mus musculus (mouse): 16193Help
Entry
16193             CDS       T01002                                 

Gene name
Il6, Il-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01523  Antifolate resistance
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu04659  Th17 cell differentiation
mmu04668  TNF signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05020  Prion diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05332  Graft-versus-host disease
mmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16193 (Il6)
   04668 TNF signaling pathway
    16193 (Il6)
   04066 HIF-1 signaling pathway
    16193 (Il6)
   04068 FoxO signaling pathway
    16193 (Il6)
   04151 PI3K-Akt signaling pathway
    16193 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16193 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16193 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    16193 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16193 (Il6)
   04620 Toll-like receptor signaling pathway
    16193 (Il6)
   04621 NOD-like receptor signaling pathway
    16193 (Il6)
   04623 Cytosolic DNA-sensing pathway
    16193 (Il6)
   04625 C-type lectin receptor signaling pathway
    16193 (Il6)
   04659 Th17 cell differentiation
    16193 (Il6)
   04657 IL-17 signaling pathway
    16193 (Il6)
   04672 Intestinal immune network for IgA production
    16193 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16193 (Il6)
   05202 Transcriptional misregulation in cancer
    16193 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16193 (Il6)
   05321 Inflammatory bowel disease (IBD)
    16193 (Il6)
   05332 Graft-versus-host disease
    16193 (Il6)
  09164 Neurodegenerative disease
   05020 Prion diseases
    16193 (Il6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16193 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16193 (Il6)
   04931 Insulin resistance
    16193 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16193 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16193 (Il6)
   05135 Yersinia infection
    16193 (Il6)
   05133 Pertussis
    16193 (Il6)
   05134 Legionellosis
    16193 (Il6)
   05152 Tuberculosis
    16193 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16193 (Il6)
   05162 Measles
    16193 (Il6)
   05164 Influenza A
    16193 (Il6)
   05161 Hepatitis B
    16193 (Il6)
   05168 Herpes simplex virus 1 infection
    16193 (Il6)
   05163 Human cytomegalovirus infection
    16193 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16193 (Il6)
   05169 Epstein-Barr virus infection
    16193 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16193 (Il6)
   05144 Malaria
    16193 (Il6)
   05142 Chagas disease (American trypanosomiasis)
    16193 (Il6)
   05143 African trypanosomiasis
    16193 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16193 (Il6)
   01523 Antifolate resistance
    16193 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16193 (Il6)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Interleukins
   16193 (Il6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6 IL23
Motif
Other DBs
NCBI-GeneID: 16193
NCBI-ProteinID: NP_112445
MGI: 96559
Ensembl: ENSMUSG00000025746
Vega: OTTMUSG00000054480
UniProt: P08505 A2RTD1
LinkDB All DBs
Structure
PDB: 

Position
5 B1; 5 15.7 cM
AA seq 211 aa AA seqDB search
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLW
EIVEMRKELCNGNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEY
HSYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALLTDKLES
QKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggataccact
cccaacagacctgtctataccacttcacaagtcggaggcttaattacacatgttctctgg
gaaatcgtggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacaacgat
gatgcacttgcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgctac
caaactggatataatcaggaaatttgcctattgaaaatttcctctggtcttctggagtac
catagctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtccttcagagagatacagaaactctaattcatatcttcaaccaagaggtaaaagattta
cataaaatagtccttcctaccccaatttccaatgctctcctaacagataagctggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaatcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

DBGET integrated database retrieval system