KEGG   Mus musculus (mouse): 16195Help
Entry
16195             CDS       T01002                                 

Gene name
Il6st, 5133400A03Rik, AA389424, BB405851, CD130, D13Ertd699e, gp130
Definition
(RefSeq) interleukin 6 signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  Jak-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16195 (Il6st)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16195 (Il6st)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16195 (Il6st)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16195 (Il6st)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    16195 (Il6st)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16195 (Il6st)
   05203 Viral carcinogenesis
    16195 (Il6st)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    16195 (Il6st)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    16195 (Il6st)
   04090 CD molecules [BR:mmu04090]
    16195 (Il6st)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   16195 (Il6st)
CD molecules [BR:mmu04090]
 Proteins
  16195 (Il6st)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind fn3_2 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 16195
NCBI-ProteinID: NP_034690
MGI: 96560
Ensembl: ENSMUSG00000021756
Vega: OTTMUSG00000044624
UniProt: Q00560 Q6PDI9
LinkDB All DBs
Position
13 D2.2; 13 63.73 cM
AA seq 917 aa AA seqDB search
MSAPRIWLAQALLFFLTTESIGQLLEPCGYIYPEFPVVQRGSNFTAICVLKEACLQHYYV
NASYIVWKTNHAAVPREQVTVINRTTSSVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTM
LSGFPPDKPTNLTCIVNEGKNMLCQWDPGRETYLETNYTLKSEWATEKFPDCQSKHGTSC
MVSYMPTYYVNIEVWVEAENALGKVSSESINFDPVDKVKPTPPYNLSVTNSEELSSILKL
SWVSSGLGGLLDLKSDIQYRTKDASTWIQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSI
KDSGKGYWSDWSEEASGTTYEDRPSRPPSFWYKTNPSHGQEYRSVRLIWKALPLSEANGK
ILDYEVILTQSKSVSQTYTVTGTELTVNLTNDRYVASLAARNKVGKSAAAVLTIPSPHVT
AAYSVVNLKAFPKDNLLWVEWTPPPKPVSKYILEWCVLSENAPCVEDWQQEDATVNRTHL
RGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAAPARGPTVRTKKVGKNEAVLAWDQI
PVDDQNGFIRNYSISYRTSVGKEMVVHVDSSHTEYTLSSLSSDTLYMVRMAAYTDEGGKD
GPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSH
IAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANNKKPCPDDLKSVDLFKKEKVSTE
GHSSGIGGSSCMSSSRPSISSNEENESAQSTASTVQYSTVVHSGYRHQVPSVQVFSRSES
TQPLLDSEERPEDLQLVDSVDGGDEILPRQPYFKQNCSQPEACPEISHFERSNQVLSGNE
EDFVRLKQQQVSDHISQPYGSEQRRLFQEGSTADALGTGADGQMERFESVGMETTIDEEI
PKSYLPQTVRQGGYMPQ
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaccaaggatttggctagcgcaagctttgctttttttcctcaccactgaatct
ataggtcaacttttggaaccgtgtggttacatctaccctgaatttccagttgtccagcgc
ggctcgaacttcactgccatttgtgtgctgaaggaggcgtgtctgcagcattactacgtg
aatgccagctacatcgtgtggaagaccaaccatgctgctgttcccagggagcaggtcact
gtcatcaacagaaccacgtccagtgtcacgttcacagacgtggtcctcccgagcgtgcag
ctcacctgcaacatcctgtcctttgggcagatcgagcagaatgtgtatggagtcaccatg
ctttcaggctttcctccagataaacctacaaatttgacttgcattgtgaatgaggggaag
aatatgctgtgccagtgggaccccggaagggagacttaccttgaaacaaactacactttg
aaatcagagtgggcaacagagaagtttcctgattgccagtcaaagcatggcacttcatgt
atggtcagctacatgcccacctattatgtcaacattgaagtctgggtggaagcagagaat
gcccttgggaaggtctcctcagagtctatcaattttgaccccgtggataaagtgaaaccc
accccaccatataatttatcagtgaccaactcagaagaattatccagtatattaaagcta
tcatgggtcagttcagggctgggcggtcttttagatctaaagtctgacatccaatatagg
accaaagatgcctcaacttggatccaggtccctcttgaagatacaatgtctcctcgaact
tccttcactgtgcaggacctcaagccttttacagaatatgtgtttaggatccggtccatt
aaggacagtgggaagggctactggagtgactggagtgaggaggctagtgggaccacatac
gaagacagaccatccagaccaccaagtttctggtataagacaaatccatcccatgggcag
gaatatagatctgtacggctcatatggaaggcactgcctctttctgaagccaatgggaaa
atcttggattatgaagtgattcttacgcagtcaaagtccgtctcacaaacgtacacagtc
actggcacagagctgaccgtgaatctcaccaatgaccgctatgtcgcgtctctagcagca
agaaacaaggtgggcaaatcagctgcagctgtcctcaccatccccagcccccacgtcaca
gctgcttattctgtagtgaatcttaaagcatttccaaaagataacctgctctgggtggaa
tggacacctccacctaaacccgtgagcaagtacatcttagagtggtgtgtgttgtcagag
aacgcaccctgtgttgaagactggcagcaggaagacgctaccgtgaatcggacccacttg
agaggacgcctcctggagagcaagtgctatcaaatcacagtaactcccgtattcgccacg
gggcccggaggctctgagtccttgaaggcgtacctcaaacaagccgctcctgccagagga
ccgactgttcggacaaagaaagtggggaaaaatgaagctgtcttagcgtgggaccagatt
cctgtggacgaccagaatggcttcattagaaactactccatatcttacagaaccagcgtg
ggaaaggagatggttgtgcatgtggattcttctcacacggagtacacgctgtcctctctg
agtagtgatacgttgtacatggtccgaatggccgcgtacacagatgaaggtgggaaagat
gggccggaattcacttttacaacaccaaagttcgctcaaggagaaatagaagccatagtc
gtgcctgtgtgcttagccttcctcctgacaaccctgctgggcgtcttgttctgctttaac
aaacgagacctaattaaaaaacacatctggcctaatgttcctgatccttccaagagtcat
attgcccagtggtcacctcacacccccccaaggcacaattttaactccaaagatcaaatg
tactcggacggcaatttcactgatgtaagcgttgtggaaatagaagcaaacaacaagaag
ccttgtccagatgacctgaagtccgtggacctgttcaagaaggagaaagtgagtacagaa
gggcacagcagtggcatcgggggctcttcatgcatgtcctcctccaggcccagcatctcc
agcaacgaggagaatgagtctgctcagagcaccgccagcacggtgcagtactccactgtg
gtgcacagcggctacaggcaccaggtcccgtccgtgcaagtgttctcaaggtccgagtcc
acccagcccctgctagactcggaggagcggccagaagacctgcagctggtggatagtgta
gacggtggggatgagatcttgcccaggcaaccgtatttcaagcagaactgcagtcagcct
gaagcctgtccagagatttcacattttgaaaggtcaaaccaggttttgtccggcaatgag
gaggattttgtcagactgaagcagcagcaggtttcagatcacatttctcagccctatgga
tccgagcaacggaggctgtttcaggaaggctctacagcggatgctcttggcacgggggct
gatggacagatggagagatttgaatctgttggaatggagaccacaattgatgaagaaatt
cccaaaagttacttgccacagactgtaagacaaggtggctacatgccgcagtga

DBGET integrated database retrieval system