KEGG   Mus musculus (mouse): 16323Help
Entry
16323             CDS       T01002                                 

Gene name
Inhba
Definition
(RefSeq) inhibin beta-A
  KO
K04667  inhibin beta A chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    16323 (Inhba)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16323 (Inhba)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16323 (Inhba)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16323 (Inhba)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   16323 (Inhba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 16323
NCBI-ProteinID: NP_032406
MGI: 96570
Ensembl: ENSMUSG00000041324
UniProt: Q04998 Q3UY39
LinkDB All DBs
Position
13 A1; 13 5.85 cM
AA seq 424 aa AA seqDB search
MPLLWLRGFLLASCWIIVRSSPTPGSEGHGSAPDCPSCALATLPKDGPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGDEAEEMGLKGERSELLLSEKVVDARKSTWHIFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEVDGDGKKKDGSDGGLEEEKEQSHRPFLMLQARQSED
HPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTS
GSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE
CGCS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgctttggctgagaggatttctgttggcaagttgctggattatagtgaggagt
tcccccaccccaggatccgaggggcacggctcagccccggactgcccgtcctgtgcgctg
gccacccttccgaaggatggacctaactctcagccagagatggtagaggctgtcaagaag
cacatcttaaacatgctgcacttgaagaagagacccgatgtcacccagccggtgcccaag
gcggcgcttctcaacgcgatcagaaagcttcatgtgggtaaagtgggggagaacgggtat
gtggagatagaggacgacattggcaggagggccgaaatgaatgaactcatggagcagacc
tcggagatcatcacctttgccgagtcaggcacagccaggaagacactgcactttgagatt
tccaaggaaggcagtgacctgtcagtagtggagcgtgcagaagtgtggctcttcctgaaa
gtccccaaggctaacagaaccaggaccaaagtcaccatccgtctatttcagcagcagaag
cacccacagggcagcttggacacgggggatgaggccgaggaaatgggcttaaagggggag
aggagtgaactgttgctatcagagaaagtagttgatgctcggaagagtacctggcacatc
tttccagtgtccagcagcatccagcgcctgctggaccagggaaagagttccctggacgtg
cggattgcttgtgagcagtgccaggagagtggtgccagtctagtgcttctgggcaagaag
aagaagaaagaggtggatggagatgggaagaagaaagatgggagtgacggagggctggaa
gaggaaaaggaacagtcacatagacctttcctcatgctgcaggctaggcagtccgaagac
caccctcatcgcaggcgtaggcggggcttggagtgcgacggcaaggtcaacatttgctgt
aagaaacagttctttgtcagcttcaaggacattggctggaatgactggatcattgctccc
tctggctatcacgccaattattgtgagggggagtgcccaagccacatagcaggcacctct
gggtcctcgctctccttccactcaacagtcattaaccactaccgcatgaggggtcacagc
ccctttgccaaccttaagtcatgctgtgtgcccaccaagctgagacccatgtccatgctg
tattacgatgatggtcaaaacatcatcaaaaaggacattcaaaacatgattgtggaggag
tgtggctgctcctag

KEGG   Mus musculus (mouse): 16324Help
Entry
16324             CDS       T01002                                 

Gene name
Inhbb
Definition
(RefSeq) inhibin beta-B
  KO
K22687  inhibin beta B chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    16324 (Inhbb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16324 (Inhbb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16324 (Inhbb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16324 (Inhbb)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   16324 (Inhbb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide US22 TctA
Motif
Other DBs
NCBI-GeneID: 16324
NCBI-ProteinID: NP_032407
MGI: 96571
Ensembl: ENSMUSG00000037035
Vega: OTTMUSG00000034781
UniProt: Q04999
LinkDB All DBs
Position
1 E2.3; 1 52.29 cM
AA seq 411 aa AA seqDB search
MDGLPGRALGAACLLLLVAGWLGPEAWGSPTPPPSPAAPPPPPPPGAPGGSQDTCTSCGG
GGGGFRRPEELGRVDGDFLEAVKRHILSRLQLRGRPNITHAVPKAAMVTALRKLHAGKVR
EDGRVEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFVSNEGNQNLFVVQA
SLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNVVEKKVDLKRSGWHTFPITEAIQ
ALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLEC
DGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVN
QYRMRGLNPGPVNSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGCA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggacgggctgcccggtcgggcgttgggggccgcctgccttctgctcctggtggccggc
tggttgggacccgaggcctggggctctcccacacccccgccgtcgcccgctgcgccgccc
ccgcccccgccacccggagctccgggtggctcgcaggacacctgtacgtcgtgcggtggc
ggcggcggcggcttccggcggccggaggagctgggccgggtggacggtgacttcctggag
gcggtgaagagacacatcttgagccgcctgcagttgcggggccggcccaacatcacgcac
gctgtccccaaggccgccatggtcacggccctgcgcaagctgcacgccggcaaggtgcgc
gaggacggccgcgtggagatcccgcacctcgacggccacgccagcccgggcgccgacggc
caggagcgcgtctccgagatcatcagctttgcagagacagatggcctcgcctcctcccgg
gtccgcctgtacttcttcgtctctaatgaaggcaaccagaacctattcgtggtgcaggcc
agcctgtggctgtacctgaaactgctcccctatgtcctggagaagggcagcaggaggaag
gtacgggtcaaggtgtacttccaagaacagggtcacggagacaggtggaatgtggtggag
aagaaggtggacctgaaacgtagcggctggcatacctttcccatcacagaggccatccag
gccttgtttgagcgaggggagagacgccttaacctggatgtgcagtgtgacagctgccag
gagctggccgtggtgcctgtgttcgtggaccccggtgaggagtcacacaggccctttgta
gtggtgcaggcccgcctgggcgatagcagacatcgcatccgcaaacggggcctagagtgt
gatgggcggaccagcctctgttgcaggcaacagttcttcatcgactttcggctcatcggc
tggaacgactggatcattgcgcccactggctactacgggaactactgtgagggcagctgc
ccggcctatctggccggggtccctggctcagcttcctccttccacacagccgtggtgaac
cagtaccgcatgcgtggcctgaaccctgggcccgtgaactcttgctgcatccctaccaag
ctgagctccatgtccatgctctactttgatgacgagtacaacattgtcaagcgggatgtg
cccaacatgatcgtggaggagtgtggctgcgcctga

KEGG   Mus musculus (mouse): 16325Help
Entry
16325             CDS       T01002                                 

Gene name
Inhbc
Definition
(RefSeq) inhibin beta-C
  KO
K22688  inhibin beta C chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    16325 (Inhbc)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16325 (Inhbc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16325 (Inhbc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16325 (Inhbc)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   16325 (Inhbc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 16325
NCBI-ProteinID: NP_034695
MGI: 105932
Ensembl: ENSMUSG00000025405
UniProt: P55104 Q3V2A6
LinkDB All DBs
Position
10 D3; 10 74.5 cM
AA seq 352 aa AA seqDB search
MASSLLLALLFLTPTTVVNPKTEGPCPACWGAIFDLESQRELLLDLAKKSILDKLHLSQR
PILSRPVSRGALKTALQRLRGPRRETLLEHDQRQEEYEIISFADTDLSSINQTRLEFHFS
GRMASGMEVRQTRFMFFVQFPHNATQTMNIRVLVLRPYDTNLTLTSQYVVQVNASGWYQL
LLGPEAQAACSQGHLTLELVPESQVAHSSLILGWFSHRPFVAAQVRVEGKHRVRRRGIDC
QGASRMCCRQEFFVDFREIGWNDWIIQPEGYAMNFCTGQCPLHVAGMPGISASFHTAVLN
LLKANAAAGTTGRGSCCVPTSRRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccttgctcctggctcttctgttcctgactccaaccacagtagtgaacccc
aaaactgagggtccatgcccagcatgttggggtgccatctttgacctggagagccagcgg
gagctgcttctcgatttggccaagaaaagtatcctggacaagctgcacctcagccagcgc
cccatactcagtcggccagtgtccagaggggctctcaagaccgcgctgcagcgcctccgc
gggcctcgacgggaaaccctgttggagcatgaccagagacaagaagaatatgagatcatc
agctttgctgacacagacctctccagcatcaaccagacccggctcgagttccacttctct
ggtagaatggccagcggcatggaggtccggcagacccgcttcatgttcttcgtacagttc
ccccacaatgccacccagaccatgaatataagagttcttgtgctaagaccatatgacacc
aacctcaccttgacaagtcagtacgtggtgcaggtgaatgccagtggctggtaccagctt
ctcctgggacctgaagctcaagctgcttgcagccagggacaccttactctggagctggta
ccagaaagccaggtggcccacagttccttgatcctgggctggttttcccacaggcctttt
gtggcagcccaggtaagggttgagggcaagcatcgggttcgccggcgaggtatcgattgc
cagggggcgtccaggatgtgctgtcgacaagagttcttcgtagacttccgtgagattggc
tggaatgactggatcatccagcctgaaggctatgccatgaacttctgcactgggcagtgc
ccactacatgtggcaggcatgcctggcatctctgcctcctttcacactgcagtgctgaat
ctgctcaaagccaacgcagctgctggcaccactggcaggggctcgtgctgcgtgcctaca
tctcggcgccctctgtctttgctctactatgacagggacagcaacattgtcaagacggat
atacctgacatggtggtcgaggcctgcgggtgtagttag

KEGG   Mus musculus (mouse): 16326Help
Entry
16326             CDS       T01002                                 

Gene name
Inhbe
Definition
(RefSeq) inhibin beta-E
  KO
K22689  inhibin beta E chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    16326 (Inhbe)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16326 (Inhbe)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16326 (Inhbe)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16326 (Inhbe)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   16326 (Inhbe)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta
Motif
Other DBs
NCBI-GeneID: 16326
NCBI-ProteinID: NP_032408
MGI: 109269
Ensembl: ENSMUSG00000047492
UniProt: O08717
LinkDB All DBs
Position
10 D3; 10 74.5 cM
AA seq 350 aa AA seqDB search
MKLPKAQLWLILLWALVWVQSTRSACPSCGGPTLAPQGERALVLELAKQQILEGLHLTSR
PRITRPLPQAALTRALRRLQPKSMVPGNREKVISFATIIDKSTSTYRSMLTFQLSPLWSH
HLYHARLWLHVPPSFPGTLYLRIFRCGTTRCRGFRTFLAEHQTTSSGWHALTLPSSGLRS
EDSGVVKLQLEFRPLDLNSTAAGLPRLLLDTAGQQRPFLELKIRANEPGAGRARRRTPTC
EPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttccaaaagcccagctctggctaatactgctgtgggcattggtgtgggtgcag
agtacaagatctgcgtgcccgtcctgtgggggcccaacactggcaccccaaggagaacgc
gctctggtcctggagctagccaagcagcaaatcctggagggactgcacctaaccagccgt
cccagaataactcggcctctgccccaggcagcactgaccagagccctccggagactgcag
cccaagagcatggtccctggcaaccgagagaaagtcatcagctttgctaccatcatagac
aaatccacttcaacctaccgctccatgctcaccttccagctgtcccctctttggtcccac
cacctgtaccatgcccgcctctggctgcatgtgcctccctcttttccgggcactctgtac
ctgaggatcttccgttgcggcaccactaggtgccgaggattccgcaccttcctagctgag
caccaaaccacttcctctggctggcacgccctgactctgccctctagcggcttgcggagt
gaggactctggcgtcgtgaaactccaactggaatttagacccctggaccttaacagcacc
gctgcgggactgccacggctgctcttggacacagcgggacagcaacgtcccttcttggaa
cttaagatccgagctaatgaacctggagcaggtcgggccaggaggaggactcccacctgt
gagcctgagacccccttatgttgtaggcgagaccactatgtagacttccaggagctgggg
tggcgggattggatcctgcagccggagggataccagctgaattactgcagtgggcagtgc
ccgccccacctggctggcagtcctggcattgctgcctccttccattctgccgtctttagc
ctcctcaaagccaacaacccttggcctgcgggttcttcctgctgtgtccccactgcacga
aggcctctctctctcctctaccttgaccataatggcaatgtggtcaagaccgatgtgcca
gacatggtagtagaggcctgtggctgcagctag

DBGET integrated database retrieval system