KEGG   Mus musculus (mouse): 16391
Entry
16391             CDS       T01002                                 

Gene name
Irf9, Irf, Irf-9, Isgf, Isgf3g, p4, p48
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16391 (Irf9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16391 (Irf9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    16391 (Irf9)
   04625 C-type lectin receptor signaling pathway
    16391 (Irf9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16391 (Irf9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    16391 (Irf9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    16391 (Irf9)
   05171 Coronavirus disease - COVID-19
    16391 (Irf9)
   05164 Influenza A
    16391 (Irf9)
   05162 Measles
    16391 (Irf9)
   05168 Herpes simplex virus 1 infection
    16391 (Irf9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16391 (Irf9)
   05169 Epstein-Barr virus infection
    16391 (Irf9)
   05165 Human papillomavirus infection
    16391 (Irf9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16391 (Irf9)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    16391 (Irf9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 16391
NCBI-ProteinID: NP_032420
MGI: 107587
Ensembl: ENSMUSG00000002325
Vega: OTTMUSG00000029027
UniProt: Q61179 Q3UKQ7
LinkDB
Structure
PDB: 
5OEM 5OEN

Position
14 C3; 14 28.19 cM
AA seq 399 aa
MASGKVRCTRKLRSWIVEQVESGHFPGVCWDDAAKTMFRIPWKHAGKQDFREDQDAAIFK
AWALFKEKHKDGDIGHPAVWKTRLRCALNKSSEFEEVPERGRMDVAEPYKVYRILPAGTL
PNQPRNQKSPCKRSISCVSPEREENMENGRTNGVVNHSDSGSNIGGGGNGSNRSDSNSNC
NSELEEGAGTTEATIREDPVFLEHQLPLNSDYSLLLTFIYGGRVVGKTQVHSLDCRLVAE
RSDSESSMEQVEFPKPDPLEPTQHLLNQLDRGVLVASNSRGLFVQRLCPIPISWNAPEAP
PGPGPHLLPSNKCVELFKTTYFCRDLAQYFQGQGPPPKFQATLHFWEESPGSSHSQENLI
TVQMEQAFARHLLEKIPEEEKAALFLLQHTEQSPSALGH
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcctcaggcaaagtacgctgcacccgaaagctgcggagctggatcgtggagcaggtg
gagagtggccatttcccaggggtgtgctgggacgatgcagccaagaccatgttccggatt
ccctggaagcatgcaggcaagcaagacttccgagaggaccaggatgctgccatattcaag
gcttgggcactgtttaaggaaaagcacaaagatggggacataggacaccccgctgtctgg
aagactcgcctacgctgtgccctcaacaagagttccgaatttgaggaggttcccgagaga
ggtcgtatggatgttgctgaaccctacaaagtatatcgaatactgccagcaggaaccctc
cctaaccaaccacggaaccagaaatcaccatgcaagcgaagtatcagttgtgtgtcacct
gagagggaagaaaatatggaaaatgggaggaccaatggcgttgtaaaccactcagacagt
ggcagcaacataggcggtggtggcaatggcagcaacaggagcgacagcaacagcaactgc
aactctgagctagaggagggagctggcacaactgaggccaccattagagaggacccagtg
ttcctggagcatcaacttcctctgaactcagactactcgctgctgctcaccttcatctat
ggtggccgagtggtgggtaagacccaggtgcacagcctagactgtcggctcgtggctgag
cgctcagactcggagagcagcatggagcaggtggagtttcccaaacccgacccactggag
cctacccagcacctgctgaatcagcttgacagaggcgtcctggtggccagcaattccaga
ggcctctttgttcagcgcctttgccccatccccatctcctggaatgcaccagaggcccca
cccgggcctggtcctcatctgctgcccagcaataagtgtgtggagctcttcaagaccacc
tacttctgtagagatttggcccagtacttccagggccaggggcccccacccaagttccaa
gcaaccctacatttctgggaggagagtcctggctctagccatagccaagagaatctcatc
acagtgcagatggagcaggcctttgcccgacatttactggagaagattccagaagaggag
aaagctgccttgttcctgttacagcacacagagcagtcaccctctgctctgggacactga

DBGET integrated database retrieval system